KEGG   Staphylococcus epidermidis RP62A: SERP1394Help
Entry
SERP1394          CDS       T00229                                 

Definition
amino acid ABC transporter ATP-binding protein
Orthology
K02028  
polar amino acid transport system ATP-binding protein [EC:3.6.3.21]
Organism
ser  Staphylococcus epidermidis RP62A
Module
Putative polar amino acid transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1449875..1450597)
Genome map
AA seq 240 aa AA seqDB search
MINIKNLNKKFGANEVLRDINLTVEKGEVVAIIGPSGSGKSTLLRCMNLLDVPSKGKVIF
EDNELTQHNVHLDNLRQKMGMVFQNFNLFPHKKVIENVMLAPLLLHKDSKDQLKEKALYL
LEKVGLKDKADSYPNQLSGGQKQRVAIARALAMEPDVMLFDEPTSALDPEVVGDVLKVMR
QLANEGMTMVIVTHEMNFAKEISDKVVFMADGVVVESGTPQNIFENPQHSRTENFLSRVL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatattaaaaatttaaataaaaaatttggagcaaatgaagtattgagagatatt
aatcttactgttgaaaagggtgaagtggttgcaataattggaccatctggaagtggtaaa
agcactttactccgttgtatgaatttgttagatgtaccttcaaaaggtaaagttatattt
gaagataatgaattaactcaacataatgttcatttagataatttacgacaaaaaatgggt
atggtatttcaaaattttaatttatttcctcataaaaaggtcattgaaaatgtaatgttg
gcaccacttttattacataaagatagtaaagatcaattaaaagagaaagctttatattta
cttgaaaaagtggggcttaaagacaaagcagattcatatcctaatcaactgtctggaggt
caaaaacaaagagttgctattgcaagagctttggcaatggaacctgatgttatgttattt
gatgaaccaacatctgcacttgatcctgaagtagtaggggatgttttaaaagtaatgaga
caattagcgaatgaaggtatgacaatggtgattgtcacgcatgagatgaactttgctaaa
gaaataagtgataaagtagtatttatggccgatggtgttgtggttgaatctggtacacca
caaaacatatttgaaaatcctcagcacagtcgaactgaaaattttttatcacgagtgtta
taa

DBGET integrated database retrieval system