KEGG   Staphylococcus epidermidis RP62A: SERP1395Help
Entry
SERP1395          CDS       T00229                                 

Definition
amino acid ABC transporter substrate-binding protein
Orthology
K02029  
polar amino acid transport system permease protein
K02030  
polar amino acid transport system substrate-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Putative polar amino acid transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1450590..1452047)
Genome map
AA seq 485 aa AA seqDB search
MKCLFKMLSIIIIMLSTFTLFISPSTYANEDENWTKIKNRGELRVGLSADYAPLEFEKTI
HGKTEYAGVDIELAKKIAKDNHLKLKIVNMQFDSLLGALKTGKIDIIISGMTTTPERKKE
VDFTKPYMITNNVMMIKKDDAKRYQNIKDFEGKKIAAQKGTDQEKIAQTEIEDSKISSLN
RLPEAILSLKSGKVAGVVVEKPVGEAYLKQNSELTFSKIKFNEEKKQTCIAVPKNSPVLL
DKLNQTIDNVKEKNLIDQYMTKAAEDMQDDGNFISKYGSFFIKGIKNTILISLVGVVLGS
ILGSFIALLKISKIRPLQWIASIYIEFLRGTPMLVQVFIVFFGTTAALGLDISALICGTI
ALVINSSAYIAEIIRAGINAVDKGQTEAARSLGLNYRQTMQSVVMPQAIKKILPALGNEF
VTLIKESSIVSTIGVSEIMFNAQVVQGISFDPFTPLLVAALLYFLLTFALTRVMNFIEGR
MSASD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttgttcaaaatgctatcaatcataataataatgttaagtactttcacctta
ttcatcagtccgagtacatatgcaaatgaagatgaaaattggactaaaataaaaaatcga
ggagaactaagagttggattgtcagctgattatgcacctttagaatttgaaaagacgata
catggtaaaactgaatatgcgggtgtagatatagaattagctaaaaagattgcgaaagat
aatcatctaaagctaaaaattgtaaacatgcaatttgatagcttattaggtgcacttaag
accggtaaaatcgatattattatctccggtatgacaacaactcccgaacgaaaaaaagaa
gtggattttacaaaaccttacatgattacaaataatgtgatgatgattaaaaaagatgat
gcaaaacgttatcaaaacatcaaagattttgaaggcaaaaaaattgctgcgcaaaaaggg
acagatcaagaaaaaattgcacaaactgagattgaagatagtaaaatttcttcactcaat
agattacctgaagctatattatctttaaaaagtggaaaagtagcaggtgtagttgttgaa
aaaccagtaggtgaggcatatttaaaacaaaattcagaactaacattttcaaagattaaa
tttaatgaagaaaagaaacaaacatgtatagctgttcctaagaactctcctgtactttta
gataagctaaatcaaacgattgataatgtaaaagaaaaaaatttaattgatcaatacatg
acaaaagcagccgaagatatgcaagatgatggaaattttatttctaaatatggcagtttt
ttcattaaaggaattaaaaatactattttgatttcattagtaggtgtggtattggggtct
attttaggctcttttatagctttattaaaaataagtaaaattagaccattacaatggata
gcaagtatatacatagaatttttaagaggtactcctatgcttgtgcaagtgtttattgta
ttttttgggactactgcagctttggggttagatatttcagctttaatttgtggtactatt
gcgcttgttataaattcttcagcctacattgccgagattattagagctggtattaatgct
gtagataaaggacaaactgaagctgctagaagtttaggattgaattatagacagactatg
caatcagtagttatgccacaggcaattaagaaaattttacctgcattaggtaatgaattt
gtaaccttgattaaagaatcgtctatagtttccacaattggagtgagtgaaatcatgttt
aatgcacaagttgtacaagggatatcttttgatcctttcacaccattgttagttgcagca
ttactatatttcttacttacatttgcacttacacgtgttatgaattttattgaagggaga
atgagtgccagtgattaa

DBGET integrated database retrieval system