KEGG   Staphylococcus epidermidis RP62A: SERP1403Help
Entry
SERP1403          CDS       T00229                                 

Definition
(GenBank) ABC transporter, permease/ATP-binding protein
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:3.6.3.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP1403
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SERP1403
Transporters [BR:ser02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    SERP1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase ABC_ATPase AAA_16 NTPase_1 AAA_29 MMR_HSR1 AAA_22 Synapsin_N Prp19
Motif
Other DBs
NCBI-ProteinID: AAW54752
UniProt: Q5HN69
Position
complement(1467814..1469550)
Genome map
AA seq 578 aa AA seqDB search
MIKRYLKFVKPYRYRIIATIIVGIIKFGIPMLIPLLIKYAIDGVINNHSLTNQEKFSHLG
VAIGIALFIFLIVRPPIEFIRQYLAQWTSNKILYDIRKQLYNHLQALSVRFYANNQVGQV
ISRVINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTFAAIFIFPFYILTVYF
FFGRLRKLTRVRSQALAEVQGFLHERVQGMSVIKSFAIEDNEAKNFDNHNKNFLQRAFQH
TRWNAYSFAAINTVTDLGPIIVIGVGSYLAITGSITVGTLAAFVGYLEQLFGPLRRLVSS
FTTLTQSFASMDRVFQLMDEDYDIKNGIGAQPIKISKGQIDLKHVSFKYNENEKEVLHDI
NLTINKGETVAFVGMSGGGKSTLINLIPRFYDVTQGEILIDHHNVKDFLTGSLRNQIGLV
QQDNILFSDTVKENILLGRPDATDDEVVEAAKMANAHDFISNLPNGYDTEVGERGVKLSG
GQKQRLSIARIFLNNPPVLILDEATSALDLESEAIIQEALDVLSKDRTTLIVAHRLSTIT
HADRIVVMENGRIVETGTHQQLINKRGAYEHLYSIQNL
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacgatatttaaagtttgtaaaaccttatagatatcgtattattgcaacaatt
atagtagggattattaaattcggtattcccatgctcatacctttattgattaaatatgct
atagatggcgtgattaataatcattcgcttacaaatcaagaaaaatttagtcaccttggt
gtagcaataggaattgcattatttattttcttaattgttcgcccgccgattgagtttatt
agacaatatttagctcaatggacaagtaataaaatactatatgatattcgtaaacaattg
tataatcacttgcaagcactaagtgttcgcttttatgcaaataatcaagtcggtcaagtc
atttcaagagtgattaatgatgtcgaacaaacaaaagactttattcttactggattgatg
aatatctggcttgactgtataacgattattatcgcactttctattatgttcttccttgat
gtaaaattgacgtttgctgcaatttttatttttccattttatattttaactgtttatttt
ttctttggaagattacgaaaacttacacgtgtgcgctcacaagctctagcagaagtacaa
ggtttcttacatgagcgggttcaaggaatgtctgttattaaaagttttgctattgaagac
aatgaagctaaaaattttgataaccataacaagaattttttacaacgagccttccaacat
acaagatggaacgcatattcttttgctgctattaatactgttacagatttaggcccaata
attgtgattggcgtgggttcatatttggcaattacaggatcgattactgtcggaactcta
gcagcatttgtcggttatctagaacaattatttggaccacttagaagactagtatcttca
tttactacacttacacaaagttttgcatctatggacagagtatttcagttaatggatgag
gattacgacatcaaaaatggcattggagcacagccaattaaaatcagtaagggtcaaatt
gatttaaaacatgtgagtttcaaatataatgaaaatgaaaaagaagtattacacgatatt
aatttaacaattaacaaaggcgaaactgtagcatttgtaggtatgagtggtggtggaaaa
tctactttgattaatcttataccaagattttatgatgttactcaaggtgaaatacttatc
gatcatcataatgttaaagatttcctaactggtagtttaaggaatcaaataggcttagta
caacaagataatattcttttttctgatacggttaaggagaatattttgttgggtaggcct
gatgcgactgatgatgaagtcgtagaagctgcaaaaatggcgaatgcccatgattttatt
tcaaatttaccgaatggatatgatactgaagtaggagaacgaggagttaaattatctggt
ggacaaaaacaaaggttgtcaattgcacgtatctttttaaataatcctcctgttttaata
ttagatgaagcaacaagtgcattggatttagagagtgaagctattattcaagaagcactt
gatgttttaagtaaggatagaacaacattaattgttgcacatcgtctatctaccattact
catgcagatagaatagttgtaatggaaaatggacgaattgttgagactggcacacaccaa
caattaattaataaacgcggtgcttatgagcatctttatagtattcaaaatttataa

DBGET integrated database retrieval system