KEGG   Staphylococcus epidermidis RP62A: SERP1455Help
Entry
SERP1455          CDS       T00229                                 

Gene name
ppaC
Definition
manganese-dependent inorganic pyrophosphatase (EC:3.6.1.1)
Orthology
K15986  
manganese-dependent inorganic pyrophosphatase [EC:3.6.1.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SERP1455 (ppaC)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     SERP1455 (ppaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520522..1521451
Genome map
AA seq 309 aa AA seqDB search
MTKTFIFGHKNPDTDAISSALIMADFEQQTGNTEAKAYRLGEISAETQFALDHFNVEAPE
LLNEDLKGQDVILVDHNEFQQSADTISNATIKHVIDHHRISNFETAGPLYYRAEPVGCSA
TILYKMYKERGFEIKPEIAGLMISAIISDSLLFKSPTCTKEDVDAAQALKDIANVDLEAY
GLEMLKAGASTTDKSAETLVNMDAKSFNMGDYVTRIAQVNTVDIDEVLDRKEEFEKVMLE
MSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFKVQLDDGMAFLSGVVSRKKQVV
PQITEVLTQ
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacttttattttcgggcacaaaaatccagatactgatgctatttcttcagct
ttaattatggctgattttgagcaacaaactggtaatactgaagcaaaagcttatcgttta
ggtgaaataagtgcggaaactcaatttgcactagatcattttaacgtagaagctccagaa
ttattaaacgaagatttaaaaggacaagatgttattttagtcgaccataacgagtttcaa
caaagtgcagatactatttcaaacgctacaattaaacatgtgatagatcatcacagaatt
tctaactttgaaacagctggccctttatactatagagcagaaccagttggttgtagtgca
acaattttatataaaatgtataaagaacgtggatttgaaattaaaccagaaatcgctgga
cttatgatttcagctataatttctgatagtttattatttaaatcacctacctgcacaaaa
gaagatgtagatgctgctcaagcacttaaagatattgcaaatgttgatttagaagcatat
ggtttagaaatgttaaaagcaggtgcttcaactacagataaatctgctgaaacacttgtc
aatatggatgctaaatcattcaatatgggagattatgtaacacgtattgctcaagtcaat
actgtagatattgatgaagttttagatcgtaaagaggaatttgaaaaagttatgttagaa
atgagtgccaatgaaaaatacgatttattcgttcttgtagttactgatattattaacagc
gattctaaaatccttgtagttggtgctgaaaaagataaagttggagaagcatttaaagta
caactagatgatggtatggctttcttatctggcgttgtatcacgaaaaaaacaagttgtt
cctcaaatcactgaagttttaactcaataa

DBGET integrated database retrieval system