KEGG   Staphylococcus epidermidis RP62A: SERP1459Help
Entry
SERP1459          CDS       T00229                                 

Gene name
blaI-1
Definition
(GenBank) penicillinase repressor
  KO
K02171  BlaI family transcriptional regulator, penicillinase repressor
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser01501  beta-Lactam resistance
Module
ser_M00627  beta-Lactam resistance, Bla system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    SERP1459 (blaI-1)
Transcription factors [BR:ser03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SERP1459 (blaI-1)
Antimicrobial resistance genes [BR:ser01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    SERP1459 (blaI-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Penicillinase_R MarR RNA_pol_Rpb5_N Glyco_hydro_85 HTH_Tnp_Tc3_2 HTH_12
Motif
Other DBs
NCBI-ProteinID: AAW54859
UniProt: Q5HN13
Position
complement(1524695..1525075)
Genome map
AA seq 126 aa AA seqDB search
MANKQVEISMAEWDVMNIIWNKKSVSANEIVVEIQKNKEVSDKTIRTLITRLYKKEIIKR
YKYNNIYFYSSIIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDIL
NDISKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccaataagcaagttgaaatatctatggctgaatgggatgttatgaatataatatgg
aataaaaaatcagtatcagctaatgaaattgtagttgagattcaaaaaaataaagaagtt
agcgataagacgattagaacattaattacaagactatataaaaaagagattataaaacgc
tataaatataataatatttatttttactcatcaattattaaagaagatgatattaaaatg
aaaactgctaaaacctttcttaataaattgtatggaggggatatgaaaagtttagtgctt
aattttgcgaaaaatgaagaattaaataacaaagaaattgaagaattgcgagacatttta
aatgatattagtaaaaaataa

DBGET integrated database retrieval system