KEGG   Staphylococcus epidermidis RP62A: SERP1459Help
Entry
SERP1459          CDS       T00229                                 

Gene name
blaI-1
Definition
penicillinase repressor
Orthology
K02171  
BlaI family transcriptional regulator, penicillinase repressor
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
beta-Lactam resistance
Module
beta-Lactam resistance, Bla system
Class
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ser00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524695..1525075)
Genome map
AA seq 126 aa AA seqDB search
MANKQVEISMAEWDVMNIIWNKKSVSANEIVVEIQKNKEVSDKTIRTLITRLYKKEIIKR
YKYNNIYFYSSIIKEDDIKMKTAKTFLNKLYGGDMKSLVLNFAKNEELNNKEIEELRDIL
NDISKK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggccaataagcaagttgaaatatctatggctgaatgggatgttatgaatataatatgg
aataaaaaatcagtatcagctaatgaaattgtagttgagattcaaaaaaataaagaagtt
agcgataagacgattagaacattaattacaagactatataaaaaagagattataaaacgc
tataaatataataatatttatttttactcatcaattattaaagaagatgatattaaaatg
aaaactgctaaaacctttcttaataaattgtatggaggggatatgaaaagtttagtgctt
aattttgcgaaaaatgaagaattaaataacaaagaaattgaagaattgcgagacatttta
aatgatattagtaaaaaataa

DBGET integrated database retrieval system