KEGG   Staphylococcus epidermidis RP62A: SERP1460Help
Entry
SERP1460          CDS       T00229                                 

Gene name
blaR1-1
Definition
regulatory protein BlaR1
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1525065..1526822)
Genome map
AA seq 585 aa AA seqDB search
MAKLLIMSIVSFCFIFLLLLFFRYILKRYFNYMLNYKVWYLTLLAGLIPFIPIKFSFFKF
NNLNNQEPTVESNSHNLNPNINTTKPVHEFTTDIHKFNWDSIDNICTVIWIVLVIILSFK
FLNSLLYLKYLKKQSLYLNEKEKDKINKILFNHQYKRNIVIRKAESIHSPITFWYGKYII
LIPSLYFKSINDKKLKYIILHEYAHAKNRDTLHLIIFHIFSIAMSYNPLIQIVKRKMIHD
NEVEADRFVLNNINKNEFKSYAEAIMDSVLKTSFFNKNILSHSFNGKKSLLKRRLINIKE
GNLKKQSKLILIFICIFTFFIMIIQSQFLMGQSLTDYNYKKPLQSDYQILDESKNFGSNS
GSFVMYSMKKDKYYIYNEKESRKRYSPDSTYKIYLALFGLDRHIISDKNSRMSWNHNHYP
FDSWNKDQDLNTAIQNSVNWYFERISNQLSKNYTSDQLKQLNYGNKNLGSYKAYWLEDSL
KISNLEQVIVLKNMMEQNNHFSKNEKKQLSSSLLIRKNENYELYGKTGTGIVNGKYNNGW
FVGYVITNHDKYYFSTHLSDEKASGENAKFINEKILKEMGVLNGQ
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttattaataatgagcatagtaagcttttgttttatatttctattgttatta
ttttttaggtacatattaaaacgctattttaattatatgttaaattataaagtttggtat
ctaactcttcttgcaggattaattcctttcatccctattaaattctctttttttaaattt
aataatttgaataatcaagagcccacagttgaaagtaattcacacaatttgaatcctaac
ataaataccactaaacctgttcatgagtttacaacagacatccataagtttaattgggat
tcaatagataatatctgcacagttatttggatagttttagttattattttaagttttaaa
tttttaaattctttattatatcttaagtatttaaagaaacagtcactttatctaaatgaa
aaagaaaaagataaaataaacaagatacttttcaatcatcaatataaaagaaatattgtg
attcgaaaagcagaatctattcattctccaataactttttggtatggaaaatatattatt
ttgattcccagtttatattttaaaagtataaatgacaaaaaactaaaatatataatattg
cacgagtatgctcatgctaaaaacagagatactttgcatttaattatctttcatattttt
tctattgctatgagttataatccactaatacaaattgtaaaaagaaagatgattcatgac
aatgaagtagaagccgatagatttgtccttaataatattaacaaaaatgaatttaagtct
tatgcggaagctattatggattccgtattaaaaacctcatttttcaacaaaaatatatta
agccattcatttaatggtaaaaaatcattactcaaaagaagattaattaatataaaagaa
ggcaatctgaagaagcagtcaaaattaattctaatttttatttgtatttttacttttttt
atcatgataattcaaagccagtttttaatggggcaatccttaactgattataattataaa
aagcccttacaaagcgattaccaaattttagatgaaagtaaaaattttggttcaaatagt
ggatctttcgttatgtacagcatgaagaaagacaaatactatatttataatgaaaaagaa
agtagaaaaagatattctcctgattcaacttacaaaatttatttagcactgtttggactt
gaccgtcatattataagtgataaaaattcacgtatgtcatggaatcataatcattatcct
ttcgattcttggaataaggatcaagatttaaatacggcaatacaaaactcagttaattgg
tacttcgaacgtattagtaatcaattatcaaagaactatacttctgatcaactcaagcaa
ttaaattatggtaataaaaatttgggaagttataaagcctattggttggaagatagtttg
aaaatatctaatcttgaacaagtaatagttttaaaaaatatgatggaacaaaataaccat
tttagtaaaaatgaaaagaaacaattatcttcttcgttattgattagaaaaaatgaaaat
tatgaattgtatgggaaaacaggtacaggtatagtaaacgggaaatataataatgggtgg
tttgtaggttacgtaattacaaatcatgataagtattatttttctacacatttatcagat
gaaaaagcctctggtgaaaatgctaaattcataaatgaaaaaatattaaaagaaatgggt
gttttaaatggccaataa

DBGET integrated database retrieval system