KEGG   Staphylococcus epidermidis RP62A: SERP1464Help
Entry
SERP1464          CDS       T00229                                 

Definition
Tn554-related, transposase C
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1529916..1530281)
Genome map
AA seq 121 aa AA seqDB search
MEKFNRQEQLKQLHAERKVKTEKKVDKAINDLVQKNKEINFNIVSKHSKVSKATLYKNNK
IRKKIEKLREQNREIFVHKNKNDGKDALISSLKRKVNSLEKEKKMLKEEISVLYSRLYED
I
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatttaatagacaagaacaattaaaacagttgcatgcagaacgaaaagttaaa
accgagaaaaaagttgataaagcaataaatgatttagttcaaaaaaataaagaaattaac
tttaacatcgtttctaaacattcaaaagtttcgaaagctacattatataaaaataataaa
attcgaaagaaaatagagaagttacgtgaacaaaacagagaaatatttgttcataaaaat
aaaaatgacggtaaagatgcgttaatctcctctttaaaaagaaaagtaaattctttagaa
aaagagaaaaaaatgttgaaagaagaaattagcgttttatattctaggctgtatgaggat
atttaa

DBGET integrated database retrieval system