KEGG   Staphylococcus epidermidis RP62A: SERP1475Help
Entry
SERP1475          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K01990  
ABC-2 type transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
ABC-2 type transport system
Brite
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    SERP1475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1539261..1540136)
Genome map
AA seq 291 aa AA seqDB search
MMKLQHITKKYGQNTVLDDIDFDFGESQIVGLIGKNGVGKTTLMKVMNNNIINYQGKVDM
PKSENVGYLIEHPKLYGNKTGLFNLKLFAQVLGDGFDKEYANHIIEAFGMKPYIKKKVNK
YSMGMKQKLSIAVSLMNKPKYLILDEPTNGMDPDGSIDVLKTIQSLVQQLEMKILISSHK
LEDIELICDRAVFLRDGKFVQDVDMKDGGPEDSTILTLQKDDFNKALDSLSENFKVQQSQ
KESGEIIIKAQNDYRELLKSLSQLDIYPKYIETRKSSLRDTYFNINQRGDK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattacaacatattaccaaaaaatatggtcaaaatactgttttagacgatata
gattttgatttcggcgagagtcaaatcgttggtcttatcggtaaaaatggagttggtaaa
acaactttgatgaaggtcatgaataataacatcattaactatcaagggaaagtcgacatg
cctaaaagtgagaatgttggttatttaattgagcatcctaagttatatggaaacaagaca
ggtttatttaatttaaaattatttgcacaagtattaggcgatggtttcgataaggaatat
gcaaatcatattattgaagcttttggaatgaaaccatatatcaagaaaaaagttaacaaa
tattcaatgggaatgaaacaaaaattatcaattgcagtttcattaatgaataaacctaaa
tacttaattttagatgaacctacaaatggtatggatccagatggttcgatagatgtatta
aagacaattcaatcacttgttcaacaattagaaatgaaaatattaatctcaagtcataaa
ttagaagacattgaattgatttgtgatagagcagtatttcttagagatggtaagttcgtt
caagatgtagatatgaaagatgggggaccagaggatagtactattcttactttacaaaaa
gatgactttaataaagctttagattctctttctgaaaactttaaagtacagcagtctcaa
aaagaatcgggagaaattatcattaaagctcaaaatgattatagagagttacttaaatcg
ttatcccaactagatatttatccaaaatatattgaaacacgtaaaagttcactacgtgat
acttactttaatattaatcaaagaggtgataaataa

DBGET integrated database retrieval system