KEGG   Staphylococcus epidermidis RP62A: SERP1508Help
Entry
SERP1508          CDS       T00229                                 

Definition
thioredoxin
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572067..1572315)
Genome map
AA seq 82 aa AA seqDB search
MNETKYLLFGSPTCMPCKNLKGILPVMNFEFEYKDVFENPELAAEHMVMSTPTMVKFVNG
QKVATKVGQGEIMKFVDEEQNK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaacaaaatacttattatttggatcaccaacttgtatgccatgtaaaaactta
aaaggaattttaccagtaatgaactttgaatttgaatataaagatgtttttgagaaccca
gaattagcagcagagcatatggttatgtcaacaccaactatggttaagttcgttaatggt
cagaaagttgctactaaagttggtcaaggtgaaattatgaaatttgtagacgaagagcag
aacaaataa

DBGET integrated database retrieval system