KEGG   Staphylococcus epidermidis RP62A: SERP1508Help
Entry
SERP1508          CDS       T00229                                 

Definition
(GenBank) thioredoxin, putative
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaredoxin Thioredoxin_3 Thioredoxin KaiB Thioredoxin_2 DUF836
Motif
Other DBs
NCBI-ProteinID: AAW54846
UniProt: Q5HMW8
Position
complement(1572067..1572315)
Genome map
AA seq 82 aa AA seqDB search
MNETKYLLFGSPTCMPCKNLKGILPVMNFEFEYKDVFENPELAAEHMVMSTPTMVKFVNG
QKVATKVGQGEIMKFVDEEQNK
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaacaaaatacttattatttggatcaccaacttgtatgccatgtaaaaactta
aaaggaattttaccagtaatgaactttgaatttgaatataaagatgtttttgagaaccca
gaattagcagcagagcatatggttatgtcaacaccaactatggttaagttcgttaatggt
cagaaagttgctactaaagttggtcaaggtgaaattatgaaatttgtagacgaagagcag
aacaaataa

DBGET integrated database retrieval system