KEGG   Staphylococcus epidermidis RP62A: SERP1510Help
Entry
SERP1510          CDS       T00229                                 

Gene name
nrdF
Definition
ribonucleotide-diphosphate reductase subunit beta (EC:1.17.4.1)
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ser00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ser00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1572986..1574008)
Genome map
AA seq 340 aa AA seqDB search
MTREIKARATNWDKDNSIALTYWKQNVKQMWTEEEFKPSKDLSVWKTLSADEQETYVKAL
SGLTGLDTTQGTEGMPLLAFHYPEEIWRGVFAFMSMMENIHHKSYSHIFTSLLERKDTHY
YLKEWVPANKYLNKKTKLITTNYYKLLKPNPTDREIYVAMASSIFLESFLFFSGFYYPLY
LAGQGKMVHSGEIIRKIILDETIHGSGTGYAAQVIFDKFSKEEQEDIRKELMELFDQLYF
NEVEYAASLYDKLGLTEDVIRYIQYNGNRALMNLGWETVFNPEPFNPIVENGLRTDTTNH
DFFSVKGDGYTLALNQVPLRDKDFDFNNVISYELSNKFLQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagaaattaaagcaagagcaacaaactgggacaaagataattcaatagcgtta
acttattggaaacaaaatgtaaaacaaatgtggactgaagaggaattcaaaccttctaaa
gatttaagtgtttggaagacattatctgcggatgaacaagaaacttatgttaaagcacta
tcaggtttaacaggtttagatacaacacagggaactgaaggaatgcctttattggctttc
cactatcccgaagagatttggagaggagtatttgcatttatgtctatgatggagaatatt
catcataagtcgtattcacatatctttacttcactacttgagagaaaagatactcattac
tacttaaaagagtgggtaccagcaaataaatatctaaacaaaaagacaaaattgattaca
actaactattataaattacttaaaccaaaccctactgatcgtgaaatttatgtagcaatg
gcttcatcaattttcttagagtcattcttattcttctctggtttctactatccattgtat
ttagctggacaaggtaaaatggttcacagtggagaaatcattcgtaagattatcttagat
gaaactattcatggtagtggtacaggatatgcagctcaagttatctttgataaattcagt
aaagaagagcaagaggatattcgtaaagagttgatggaactatttgatcaactttacttc
aatgaggttgaatatgcagcttcattatacgataagttaggtttaactgaagacgttatt
cgttacattcaatataacggtaatcgtgctttaatgaacttaggttgggagacagtattt
aacccagagccatttaaccctattgtagaaaatggtttgagaacagatacaactaaccat
gacttcttctcagttaaaggtgacggttatacattagcattaaatcaagtacctttacgt
gataaagactttgatttcaacaatgttatttcatacgagttatctaacaaattcttacaa
taa

DBGET integrated database retrieval system