KEGG   Staphylococcus epidermidis RP62A: SERP1524Help
Entry
SERP1524          CDS       T00229                                 

Definition
(GenBank) methyltransferase domain protein
  KO
K15256  tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     SERP1524
Transfer RNA biogenesis [BR:ser03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    SERP1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Ubie_methyltran Methyltransf_23 Methyltransf_12 Rsm22 RrnaAD GDC-P FtsJ CSRNP_N
Motif
Other DBs
NCBI-ProteinID: AAW54884
UniProt: Q5HMV4
Position
complement(1583342..1584028)
Genome map
AA seq 228 aa AA seqDB search
MNYNPFQWTFKSEQTANEFNEHVEKSVPFYKEIHKIVKIIGGFFVEENTNVYDIGSSTGN
LLKGMSNILKRNANYIGIDNSIYMNQVAMNDADSDNIKIISEDVQDFKFTNASYITSILT
LQFINIEDREKTIKNVYQGLNKGGAFILVEKVNGEFVQSHEIMNQIYHDFKLENGLTYEE
VIKKSQSIRGVLKPLTLKQNKRMLEKAGFKDIDTWFKWNNFVGIIAVK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaattataacccttttcagtggacatttaaatcagagcaaacagctaatgaatttaat
gaacacgtagaaaaatctgtaccattctataaagagatacataagattgttaaaattatc
ggcggttttttcgttgaggaaaatacaaatgtctatgatataggctcctcgactggtaat
ttattaaaaggcatgagcaatattctaaaacgtaatgctaattatattggaattgataat
tctatttatatgaaccaagtggcaatgaatgacgctgatagtgataatatcaaaataata
tctgaagacgtgcaagattttaaattcacaaacgcttcatacattacttctattttaact
ttgcaatttataaatattgaggatagagaaaagacaataaaaaatgtttatcaaggcttg
aataaaggtggagcatttatccttgttgagaaagtaaatggagaatttgtacaatcacac
gaaatcatgaaccaaatatatcatgattttaaacttgagaatggtttgacctatgaagaa
gtgatcaagaaatctcaatcaattagaggagtattaaagcctttaaccttaaaacaaaat
aaaagaatgcttgaaaaagctggttttaaggatatagatacttggtttaaatggaacaac
tttgtaggaataattgcagttaagtag

DBGET integrated database retrieval system