KEGG   Staphylococcus epidermidis RP62A: SERP1524Help
Entry
SERP1524          CDS       T00229                                 

Definition
methyltransferase domain-containing protein
Orthology
K15256  
tRNA (cmo5U34)-methyltransferase [EC:2.1.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1583342..1584028)
Genome map
AA seq 228 aa AA seqDB search
MNYNPFQWTFKSEQTANEFNEHVEKSVPFYKEIHKIVKIIGGFFVEENTNVYDIGSSTGN
LLKGMSNILKRNANYIGIDNSIYMNQVAMNDADSDNIKIISEDVQDFKFTNASYITSILT
LQFINIEDREKTIKNVYQGLNKGGAFILVEKVNGEFVQSHEIMNQIYHDFKLENGLTYEE
VIKKSQSIRGVLKPLTLKQNKRMLEKAGFKDIDTWFKWNNFVGIIAVK
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaattataacccttttcagtggacatttaaatcagagcaaacagctaatgaatttaat
gaacacgtagaaaaatctgtaccattctataaagagatacataagattgttaaaattatc
ggcggttttttcgttgaggaaaatacaaatgtctatgatataggctcctcgactggtaat
ttattaaaaggcatgagcaatattctaaaacgtaatgctaattatattggaattgataat
tctatttatatgaaccaagtggcaatgaatgacgctgatagtgataatatcaaaataata
tctgaagacgtgcaagattttaaattcacaaacgcttcatacattacttctattttaact
ttgcaatttataaatattgaggatagagaaaagacaataaaaaatgtttatcaaggcttg
aataaaggtggagcatttatccttgttgagaaagtaaatggagaatttgtacaatcacac
gaaatcatgaaccaaatatatcatgattttaaacttgagaatggtttgacctatgaagaa
gtgatcaagaaatctcaatcaattagaggagtattaaagcctttaaccttaaaacaaaat
aaaagaatgcttgaaaaagctggttttaaggatatagatacttggtttaaatggaacaac
tttgtaggaataattgcagttaagtag

DBGET integrated database retrieval system