KEGG   Staphylococcus epidermidis RP62A: SERP1588Help
Entry
SERP1588          CDS       T00229                                 

Definition
(GenBank) IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS240 rve DUF2683 Melibiase_2_C
Motif
Other DBs
NCBI-ProteinID: AAW54936
UniProt: Q5HMP0
Position
1617188..1617610
Genome map
AA seq 140 aa AA seqDB search
MAFLLLHNYTDFIHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAK
VIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNR
RSLQIYGFSPCHEISIMLAS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcctttttacttttacacaattatacggactttatccatacattagatatttggttg
cgtaagcaacgagataatcattcagcatatgcgtttattaaacgtctcattaaacaattt
ggtaaacctcaaaaggtaattacagatcaggcaccttcaacgaaggtagcaatggctaaa
gtaattaaagcttttaaacttaaacctgactgccattgtacatcgaaatatctgaataac
ctcattgagcaagatcaccgtcatattaaagtaagaaagacaaggtatcaaagtatcaat
acagcaaagaatactttaaaaggtattgagtgtatttacgctctatataaaaagaaccgc
aggtctcttcagatctacggattttcgccatgccacgaaattagcatcatgctagcaagt
taa

DBGET integrated database retrieval system