KEGG   Staphylococcus epidermidis RP62A: SERP1588Help
Entry
SERP1588          CDS       T00229                                 

Definition
IS431mec-like transposase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1617188..1617610
Genome map
AA seq 140 aa AA seqDB search
MAFLLLHNYTDFIHTLDIWLRKQRDNHSAYAFIKRLIKQFGKPQKVITDQAPSTKVAMAK
VIKAFKLKPDCHCTSKYLNNLIEQDHRHIKVRKTRYQSINTAKNTLKGIECIYALYKKNR
RSLQIYGFSPCHEISIMLAS
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcctttttacttttacacaattatacggactttatccatacattagatatttggttg
cgtaagcaacgagataatcattcagcatatgcgtttattaaacgtctcattaaacaattt
ggtaaacctcaaaaggtaattacagatcaggcaccttcaacgaaggtagcaatggctaaa
gtaattaaagcttttaaacttaaacctgactgccattgtacatcgaaatatctgaataac
ctcattgagcaagatcaccgtcatattaaagtaagaaagacaaggtatcaaagtatcaat
acagcaaagaatactttaaaaggtattgagtgtatttacgctctatataaaaagaaccgc
aggtctcttcagatctacggattttcgccatgccacgaaattagcatcatgctagcaagt
taa

DBGET integrated database retrieval system