KEGG   Staphylococcus epidermidis RP62A: SERP1650Help
Entry
SERP1650          CDS       T00229                                 

Definition
prophage, amidase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1689084..1690475
Genome map
AA seq 463 aa AA seqDB search
MEPGCIDVDRSFHAQCMDLVIDYCLWISDNQFRIRGNAKQAIDNPLPKGWKIIRNERATV
PKQGWIGVNTSTYYGHIWLVDKGATQMTMPVIEQNWNSLANLKPKRRLDYYYGCTHFIVP
PISSNNAIVRAAKNVLPSPKPMKVLLVAGHGKGAYSNDPGVVNTELDICERDFVRQKIVP
NVAKYLKQAEVNVQLYGGSTMNQDMYQDTRYGVNLGDTKRYGMYWAARQGFDQIVEFHLD
AASPQASGGHVIIDNNVYQDKIDERLHKVIDKYVGTIRGIDKRDNLLNANVSADLNQNYR
LVELGFITNKTDVRNIERHLEAFTKEMAEAIVGNVIGNNLGSQDIKPSTKKGTKSKPSKK
KPEPQQIEWKWSGTFYPNTSIKVRRNWGLNGEEVPRKFWLNGEKDWVYIHSVIKDTKNKL
WWAKMTYPQNKEIKYFYCALGKITDKEAKIKKEKELYGKIKWK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgggctgtattgatgttgatcgtagcttccatgctcaatgtatggatctcgta
atcgactattgtttatggatatctgataatcaatttagaattcgtggtaatgcaaaacaa
gctatcgacaaccctcttccaaaaggctggaaaattattcgtaatgaaagagccacagtg
ccgaaacagggctggataggtgttaatacaagcacatattatggtcatatttggctcgtt
gataaaggtgctactcaaatgactatgcctgttattgagcaaaactggaattcgttagcg
aacttaaaaccaaaacgtagacttgattactactatggttgtactcactttatcgttccg
ccaattagttcaaataatgctattgtgagagctgctaagaacgttttacctagtcctaaa
cctatgaaagtattacttgtagctggacatggtaaaggtgcttattcaaacgatcctggt
gtagtaaatactgaattagatatttgtgaaagagactttgttagacaaaaaatcgttcct
aatgttgctaagtatcttaaacaagcagaagtaaatgttcagttgtatggtggttctact
atgaaccaagacatgtaccaagacactagatatggtgttaatcttggagatactaagaga
tatggaatgtactgggctgctcgacaaggtttcgatcaaattgttgaattccatttggac
gcagctagtccacaagcttctggtggtcatgtaattattgataataacgtatatcaagat
aagattgatgaaagacttcataaagttattgataaatacgttggtacaattcgaggtata
gacaagcgtgataacttattgaatgctaacgtatctgccgacctaaaccaaaattataga
ttagttgaattaggtttcattactaataaaactgatgtaagaaatatcgagagacatctt
gaagctttcactaaagaaatggctgaagctattgttggtaatgttatcggtaataactta
ggttctcaagatataaagccttctactaaaaaaggtactaaatctaaaccttctaagaaa
aaacctgaacctcaacaaattgagtggaagtggtctggcactttctaccctaatacatcg
atcaaagttagaagaaactgggggcttaacggtgaagaagttcctagaaaattctggctt
aatggagaaaaagactgggtatatatccattcagttatcaaagatactaagaataaatta
tggtgggctaagatgacttatcctcaaaacaaggaaattaaatacttctattgtgcttta
ggtaaaatcactgataaagaagccaaaattaaaaaagaaaaagaattatatggtaaaatt
aaatggaagtaa

DBGET integrated database retrieval system