KEGG   Staphylococcus epidermidis RP62A: SERP1658Help
Entry
SERP1658          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K06158  
ATP-binding cassette, subfamily F, member 3
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1695953..1697887
Genome map
AA seq 644 aa AA seqDB search
MILLQLNDISKSFDGEDIFTDVNFEVKTGERIGVVGRNGAGKSTLMKIIAGVENYDSGRI
SKIKNLTMSYLTQQMTLNSEATVFEEMSKPFEHIKKIENLIKDETDWLARNGQDYESDEY
QSHIEKYETLTNRYEQLDGYQYESKIKTVLHGLNFTESDFNKPINDFSGGQKTRLSLAQM
LLKEPDLLLLDEPTNHLDMETTKWLEDYLKYFKGAIVIISHDRYFLDKIVTQVYDVALGN
VKHYVGNYEQFIKQRNQYYEKRMQEFEKQQEEIKRLETFVEKNITRASTSGMAKSRRKTL
EKMERIDKPMIDARSANIQFGFDRNTGNDVMHIHDLKIGYDSPITLPINLEIFKGDHIAI
IGPNGVGKTTLIKTIAEKKHKLGGQIIFGANLQIGYYDQKQAEFKSNKTILDYVWDQYPH
MNEKDVRAVLGRFLFVQEDVKKIINDLSGGEKARLQLALLMLQRDNVLILDEPTNHLDID
SKEMLEQALKDFEGTIIFVSHDRYFINQLANKVFDLNINGGQMYLGDYQYYIEKTEEAAA
IKAHETITQNNFENKEINQDANTSTYISQKQQKRQQRKLERQIEHCERQIEELEAQISHI
DEQLTQPEVFNDPLKASKFANQKSDTEQKLEQIMLEWEKLQEKL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgatacttttacaacttaatgacatctccaaatcgttcgatggtgaagatatcttcaca
gatgttaattttgaggtgaaaactggcgaaagaatcggcgtagtaggccgtaatggagct
ggtaaatcgacattaatgaaaatcatagcaggtgtggaaaattacgatagtggtcgaata
tcaaaaatcaaaaatttgacaatgagttatttaactcagcaaatgacactcaattcagaa
gctactgtctttgaagaaatgtctaagccttttgaacatataaagaaaattgaaaattta
attaaggatgaaaccgattggcttgcacgaaatggacaagattatgaatccgatgaatat
caatcacatattgaaaaatatgaaactttaacgaatcgttatgagcaattagatggttat
caatatgagagtaaaattaaaacagtcctgcacgggcttaactttacagaaagcgatttc
aacaagcctattaatgattttagtggtggtcaaaaaacacgtctttctcttgctcaaatg
ttacttaaagaacccgatttactccttcttgatgaaccaactaaccatctagacatggaa
acaaccaagtggttagaggattacttaaagtactttaaaggggcaattgtaattatcagt
catgatagatattttttagataaaattgtaactcaagtttatgatgttgctctaggaaat
gtaaaacactatgtaggaaactatgagcaatttataaagcaacgtaatcagtattacgaa
aaacgcatgcaagaatttgaaaagcaacaagaagaaatcaagcgtttagaaacctttgta
gaaaaaaatattactcgtgcatctacaagcggcatggctaagagtagacgtaaaacattg
gaaaaaatggaacgtattgataaacctatgatagatgctagaagtgcaaatatacaattt
ggcttcgaccgtaatactggtaatgatgtgatgcacattcatgatttaaaaattggttac
gactcacctattacactacctataaacctcgaaatctttaaaggggatcatatagctatc
attggtccaaatggtgttggtaaaacaacattgataaaaacaattgctgaaaaaaaacat
aaactaggtggtcaaattatctttggtgctaatttacaaattggttactatgatcaaaaa
caagctgaatttaaatcaaataaaaccattctcgattatgtttgggatcaatatccacac
atgaatgaaaaagatgtacgggcagtattagggcgtttcttgttcgttcaagaagacgta
aaaaaaattatcaatgacttatccggcggcgaaaaggcacgattacaattagcactttta
atgttacaacgtgataatgttcttatcctagatgaaccgactaaccatttagatattgat
tctaaagaaatgcttgaacaagcattgaaagattttgaaggcacaattatttttgtatca
catgatcgttattttattaaccaacttgcaaataaagtttttgatttaaacattaatggt
ggccaaatgtatttgggagattatcagtattatattgagaaaactgaagaagctgcagct
atcaaagcacatgaaacaataactcaaaataattttgaaaataaagagataaatcaagac
gcaaatacttcaacctatatcagtcaaaagcaacaaaaaagacaacaacgtaaattagaa
agacaaattgaacattgtgaaagacaaatcgaagaattagaagcacaaatatcacatatc
gacgaacagttaacacaacctgaagtatttaacgaccctctaaaagctagtaaatttgcc
aatcaaaaatccgataccgaacaaaaattagaacaaataatgttggaatgggaaaaatta
caagaaaagctctaa

DBGET integrated database retrieval system