KEGG   Staphylococcus epidermidis RP62A: SERP1747Help
Entry
SERP1747          CDS       T00229                                 

Gene name
deoD
Definition
purine nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ser00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ser00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ser00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1785492..1786202
Genome map
AA seq 236 aa AA seqDB search
MTESTPHINPNGVKIAKTVLMPGDPLRAQYIAENFLENVEQFNTVRNMFGYTGTYKGKEV
SVMGSGMGIPSIGIYSYELYHFFDVDTIIRVGSCGALQEDVNLYDVIIAQAASTNSNYVD
QFNIPGHFAPIADYNLVAKAKKAADEIGAISHVGNVLSSDTFYNADSTFNDSWKKMGILG
IEMESAGLYLNAIHANKKALGIFTVSDHILRDEATSAEERQTSFTQMMEIALEIAE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagtacacctcacattaacccaaatggagttaaaatagctaaaactgtatta
atgccaggcgacccattacgtgctcaatatattgctgaaaattttttagaaaatgttgaa
caattcaatacagtacgtaatatgtttggttacacaggaacttataaaggcaaagaagtt
tctgtgatgggctctgggatgggaattccaagtattggtatttattcctatgaactttac
catttctttgatgtggatacaatcattcgcgtaggttcatgtggcgctcttcaagaagat
gtcaatttatatgatgtgattattgcacaagccgcttccacaaactcaaattatgttgat
caatttaatataccaggtcactttgcgcctattgctgattataatctagtagctaaagct
aagaaagctgctgatgaaattggtgccatatcacatgtaggtaacgttttgtcatctgat
acattttataatgctgattcaacttttaatgattcatggaaaaagatgggtatcttaggt
atcgaaatggaatctgcaggtctatatttaaatgccatccatgcaaataaaaaggcttta
ggtatttttacagtaagtgatcatattctaagagatgaagccactagtgcagaagagaga
caaacatcatttactcaaatgatggaaatagcgctcgaaatagctgaatag

DBGET integrated database retrieval system