KEGG   Staphylococcus epidermidis RP62A: SERP1747Help
Entry
SERP1747          CDS       T00229                                 

Gene name
deoD
Definition
purine nucleoside phosphorylase (EC:2.4.2.1)
Orthology
K03784  
purine-nucleoside phosphorylase [EC:2.4.2.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SERP1747 (deoD)
   00240 Pyrimidine metabolism
    SERP1747 (deoD)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SERP1747 (deoD)
Enzymes [BR:ser01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     SERP1747 (deoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1785492..1786202
Genome map
AA seq 236 aa AA seqDB search
MTESTPHINPNGVKIAKTVLMPGDPLRAQYIAENFLENVEQFNTVRNMFGYTGTYKGKEV
SVMGSGMGIPSIGIYSYELYHFFDVDTIIRVGSCGALQEDVNLYDVIIAQAASTNSNYVD
QFNIPGHFAPIADYNLVAKAKKAADEIGAISHVGNVLSSDTFYNADSTFNDSWKKMGILG
IEMESAGLYLNAIHANKKALGIFTVSDHILRDEATSAEERQTSFTQMMEIALEIAE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagtacacctcacattaacccaaatggagttaaaatagctaaaactgtatta
atgccaggcgacccattacgtgctcaatatattgctgaaaattttttagaaaatgttgaa
caattcaatacagtacgtaatatgtttggttacacaggaacttataaaggcaaagaagtt
tctgtgatgggctctgggatgggaattccaagtattggtatttattcctatgaactttac
catttctttgatgtggatacaatcattcgcgtaggttcatgtggcgctcttcaagaagat
gtcaatttatatgatgtgattattgcacaagccgcttccacaaactcaaattatgttgat
caatttaatataccaggtcactttgcgcctattgctgattataatctagtagctaaagct
aagaaagctgctgatgaaattggtgccatatcacatgtaggtaacgttttgtcatctgat
acattttataatgctgattcaacttttaatgattcatggaaaaagatgggtatcttaggt
atcgaaatggaatctgcaggtctatatttaaatgccatccatgcaaataaaaaggcttta
ggtatttttacagtaagtgatcatattctaagagatgaagccactagtgcagaagagaga
caaacatcatttactcaaatgatggaaatagcgctcgaaatagctgaatag

DBGET integrated database retrieval system