KEGG   Staphylococcus epidermidis RP62A: SERP1777Help
Entry
SERP1777          CDS       T00229                                 

Definition
(GenBank) iron compound ABC transporter, iron compound-binding protein
  KO
K02016  
iron complex transport system substrate-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP1777
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    SERP1777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1821012..1822007)
Genome map
AA seq 331 aa AA seqDB search
MRGLKILSVIGLLFVLIATAACGNNSSSNSSKESSKDGVEIKHEEGTTKVPKHPKRVVVL
EYSFVDALVALDVKPVGIADDNKKNRIIKPLRDKIGKYTSVGTRKQPNLEEISKLKPDLI
IADNNRHKGIYKDLNKIAPTIELKSFDGDYNENIDAFKTISKALGKEEEGKKRLEEHDKK
IEEYKKEITMDKNQKVLPAVAAKSGLLAHPSNSYVGQFLSQLGFKEALSDDVTKGLSKYL
KGPYLQMNTETLSQVNPERMFIMTNKASSNEPSLKELEKDPVWKKLNAVKNQRVDILDRD
LWARSRGLISSEEMAKELVELSKKDSKKDNK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggtttaaaaattttaagtgtaattggcttattgtttgttttaattgcaactgca
gcatgtggaaataatagttcaagtaactcaagtaaagagtcatcaaaagatggagttgaa
atcaagcacgaagaaggtactacgaaagtacctaaacaccctaaacgtgttgttgttctt
gagtattcatttgttgatgcgttagttgctttagatgttaaacctgttgggatagcggat
gataacaaaaaaaatcgtattattaaaccattaagagataaaattggaaaatacacttct
gtaggaacacgtaagcaacctaacttagaagaaatcagtaaacttaaaccagatttaatt
attgctgataataatagacacaaaggtatttataaagacttaaataaaattgctcctacg
attgaactgaaaagtttcgatggagattataatgaaaatattgatgcttttaaaacaatt
tcaaaagctttaggtaaagaagaagaaggtaaaaaacgcttagaagaacacgataagaaa
attgaagaatataaaaaagaaataactatggataaaaatcaaaaggtattgcctgcagta
gctgctaaatcaggtttgcttgctcatccaagcaactcttatgttggtcaattcctaagt
caactaggttttaaagaagcattaagtgatgatgttactaaaggtttaagtaagtatctt
aaaggaccttacttacaaatgaacactgaaactttatctcaagtgaatcctgagcgtatg
ttcataatgacaaacaaagcaagttctaacgaaccttcactaaaagaactagaaaaagat
cctgtatggaagaaattaaacgctgtgaaaaatcaacgtgttgatattttagaccgtgac
ttatgggcaagatcacgtggtttaatttcttcagaagaaatggcaaaagaacttgttgaa
ttatctaagaaagatagtaaaaaagataataagtaa

DBGET integrated database retrieval system