KEGG   Staphylococcus epidermidis RP62A: SERP1777Help
Entry
SERP1777          CDS       T00229                                 

Definition
iron ABC transporter substrate-binding protein
Orthology
K02016  
iron complex transport system substrate-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1821012..1822007)
Genome map
AA seq 331 aa AA seqDB search
MRGLKILSVIGLLFVLIATAACGNNSSSNSSKESSKDGVEIKHEEGTTKVPKHPKRVVVL
EYSFVDALVALDVKPVGIADDNKKNRIIKPLRDKIGKYTSVGTRKQPNLEEISKLKPDLI
IADNNRHKGIYKDLNKIAPTIELKSFDGDYNENIDAFKTISKALGKEEEGKKRLEEHDKK
IEEYKKEITMDKNQKVLPAVAAKSGLLAHPSNSYVGQFLSQLGFKEALSDDVTKGLSKYL
KGPYLQMNTETLSQVNPERMFIMTNKASSNEPSLKELEKDPVWKKLNAVKNQRVDILDRD
LWARSRGLISSEEMAKELVELSKKDSKKDNK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggtttaaaaattttaagtgtaattggcttattgtttgttttaattgcaactgca
gcatgtggaaataatagttcaagtaactcaagtaaagagtcatcaaaagatggagttgaa
atcaagcacgaagaaggtactacgaaagtacctaaacaccctaaacgtgttgttgttctt
gagtattcatttgttgatgcgttagttgctttagatgttaaacctgttgggatagcggat
gataacaaaaaaaatcgtattattaaaccattaagagataaaattggaaaatacacttct
gtaggaacacgtaagcaacctaacttagaagaaatcagtaaacttaaaccagatttaatt
attgctgataataatagacacaaaggtatttataaagacttaaataaaattgctcctacg
attgaactgaaaagtttcgatggagattataatgaaaatattgatgcttttaaaacaatt
tcaaaagctttaggtaaagaagaagaaggtaaaaaacgcttagaagaacacgataagaaa
attgaagaatataaaaaagaaataactatggataaaaatcaaaaggtattgcctgcagta
gctgctaaatcaggtttgcttgctcatccaagcaactcttatgttggtcaattcctaagt
caactaggttttaaagaagcattaagtgatgatgttactaaaggtttaagtaagtatctt
aaaggaccttacttacaaatgaacactgaaactttatctcaagtgaatcctgagcgtatg
ttcataatgacaaacaaagcaagttctaacgaaccttcactaaaagaactagaaaaagat
cctgtatggaagaaattaaacgctgtgaaaaatcaacgtgttgatattttagaccgtgac
ttatgggcaagatcacgtggtttaatttcttcagaagaaatggcaaaagaacttgttgaa
ttatctaagaaagatagtaaaaaagataataagtaa

DBGET integrated database retrieval system