KEGG   Staphylococcus epidermidis RP62A: SERP1781Help
Entry
SERP1781          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826305..1828266
Genome map
AA seq 653 aa AA seqDB search
MNFNQFINKQNIIMTEDEHNVYDFLKHHNPNWSSNYIDHLLDGRDKVSQRLITSLHRENL
VKSRDHSRILNRHQFAGYGVNVIAILEIYFPTSNIYLYAPITGMHAFDRIDVEGPFYFKN
LSKEDDFERVLHPNQILDWILIEDENLNNEASVQFRNDLNNSAANMTFALSFQHYTMRNE
RAPLYNLIKNANDSYLRSEQSVIEGHPLHPGAKLRKGMNAEENFMYSSEFGNVIHLRAVF
IHKSISRIQSSNVDYNVAVKQMFPDLIKTLEKEFGEDFNLQNYHLMMVHPWQIKHILQSD
YRDELNEKLILISNHSVPYYAGLSFRTLVPKQPDLSPHIKLSTNVHITGEIRTLSEQTTY
NGPLVTQILREIMSKDEDFSHYQSTYIDENAGIHFYNRNDNEAIQTDRSEQLGTLFRNNL
YQFISNETVPVIPSSLVATYPYNTEAPICTLIKTYQNTYQYKNYEEAAKQWIKDYSKALL
GLVIPLYSKYGISLEAHLQNSVATFNKDGSLNMIYIRDFEGLRIDNEQLNNAGFTTRHFH
EKSRILTNSKTSVFNKMFYSTVQNHLGELVITIAKYSNSKVLEQEIWQIISQTVEDIFNH
MTHISKQHLNNIKRTIFASEIDYKCVTTMRLEDQAHEYTYIKVHNPLHRKNDL
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcaatcaatttataaataaacaaaatataataatgactgaagatgaacataat
gtatatgactttcttaaacatcataatcctaattggtcttctaattatattgatcattta
ttagatggacgtgataaagtaagtcaacgtttaattacatctttacatagggagaattta
gtaaaaagtcgcgatcatagtcgtatacttaatcgacatcagtttgctggatacggagtt
aatgtgattgccattttagaaatctattttccaacatctaatatttatttgtatgcacca
ataactggaatgcatgcattcgatcgcattgatgttgaaggacctttttattttaagaat
ctaagtaaagaagatgattttgaacgtgtactacatcctaatcaaatattagattggata
ttaattgaagatgaaaacttaaataacgaggctagcgtacaatttagaaatgatttaaat
aatagtgcagctaatatgacttttgctttaagtttccagcactatacgatgcgtaatgaa
agagcgccattatataaccttattaaaaatgcaaatgatagttacttgcgttccgaacaa
tctgtcatcgaaggtcatccccttcatcctggtgctaagttaagaaaaggaatgaatgct
gaggaaaactttatgtattcatcagaatttggtaatgttattcatctaagagccgttttt
attcataaaagtataagtcgtattcaatcatcgaatgtagattacaatgttgccgtaaag
caaatgtttcccgacttaattaaaaccttagaaaaagaatttggcgaagattttaattta
caaaattatcatttaatgatggttcacccttggcaaataaaacatattttacaaagtgat
tatcgggatgaactaaatgaaaagttaatattgataagtaatcattcggtaccatattat
gccggtctatcatttagaacgttagtacctaaacaacctgatttatccccgcacatcaag
ttatcgacgaatgtacatataaccggtgagattcgaacattgtctgaacaaacgacatat
aatggaccactagtgacgcaaattttaagagagattatgtcaaaagatgaagatttttca
cattatcaatctacttatatcgatgaaaatgcagggattcacttttataatcgaaacgac
aatgaggcaattcaaacagatagaagtgaacaattagggactttgtttagaaataattta
tatcaatttatatctaatgaaacagtgccagtaattccatcaagtttggttgcgacctat
ccttataatactgaagcaccaatctgtacgttaatcaaaacgtatcaaaatacgtatcaa
tataaaaattatgaagaagcagcgaaacaatggattaaagactatagcaaagctcttctt
ggcttagttatccctctttattcaaaatatggaatttcgctagaggcacatttacaaaat
tcagtggcaacttttaataaagatggctcactaaatatgatttatatcagggactttgaa
ggattacgtattgataatgaacaattgaataatgctggatttaccactagacatttccat
gaaaaatctagaatccttacaaattctaaaacatcagtatttaataaaatgttctattca
acagttcaaaatcatttaggtgaactcgttattacaatagctaaatattctaatagtaaa
gtccttgaacaagaaatatggcaaattatttcacaaacagtagaagacatttttaatcac
atgactcacatttcaaaacaacatctcaacaacatcaagcgcactattttcgcatccgaa
atcgattataagtgtgtcacaacaatgcgtttagaggatcaagcacatgaatatacgtat
attaaagtgcataatccacttcatagaaagaatgatttataa

DBGET integrated database retrieval system