KEGG   Staphylococcus epidermidis RP62A: SERP1796Help
Entry
SERP1796          CDS       T00229                                 

Gene name
lacR
Definition
lactose phosphotransferase system repressor
Orthology
K02530  
DeoR family transcriptional regulator, lactose phosphotransferase system repressor
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841734..1842489)
Genome map
AA seq 251 aa AA seqDB search
MNKYDRLDEITKLVNKRGSVRTNEIVEDLNVSDMTVRRDLAELEEKGVLTKIHGGARSNS
AFQYKEMSHQEKHTRFIEEKRFIAKNAVDLIEDGDTIFLGPGTTVQKLAEEINHYSLTII
TNCLPVFNILIKKQTLHFRVYLLGGEMRDLTEAFVGEMTNQLLSQLRFSKMFFSSNGVKD
GLAMTSSIEEAYTQQIALSHSLEKYLLIDSSKIGKDDFSSFCELRELNAVLTDNNDLEKK
EKIESYVEVIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaatatgataggttagatgaaatcacaaaattagtaaataaacgaggttctgta
agaacaaatgaaatcgtcgaagatctaaatgtgtcagatatgactgtgcgccgtgatctc
gcagagcttgaagaaaaaggtgttctcactaaaatacatggtggtgctcgtagtaattca
gctttccaatataaagaaatgtctcatcaagaaaaacatacacgttttattgaagaaaaa
cgatttatagcaaagaatgcagtagatttaattgaagatggagatactattttcttaggt
ccaggtactacagttcaaaaattagctgaagaaataaatcattattcattaacaattatt
actaattgtttaccagtatttaatatattaataaaaaaacaaacgttacatttcagagtc
tatttattaggtggggaaatgcgtgatttaactgaagcatttgtaggtgagatgacaaat
cagttattaagtcaactaagatttagtaaaatgttttttagtagtaatggtgttaaagat
ggtctagctatgacatcctcaatagaagaggcttatacgcaacaaattgcacttagccat
tcgttggaaaaatatttactgattgactcttcaaaaattggtaaggatgatttttcatca
ttttgtgagcttcgtgaactcaatgcagttttaacagataataatgacttggaaaagaaa
gaaaaaatagaatcatatgttgaggttattagctaa

DBGET integrated database retrieval system