KEGG   Staphylococcus epidermidis RP62A: SERP1802Help
Entry
SERP1802          CDS       T00229                                 

Gene name
cbiO
Definition
cobalt transporter ATP-binding subunit
Orthology
K16787  
energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Energy-coupling factor transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1846504..1847364)
Genome map
AA seq 286 aa AA seqDB search
MSIQFNQVSYIYQQGTPYEFEAIKNVSLTLEQGKYYAIIGQTGSGKSTLIQHLNALLKPT
TGSVNINGLEVTNKTKDKHLRHIRKEVGIVFQFPESQLFEDSVEKEIEFGPKNFNMNLKN
VKDKAFQLLLELGFSRNVMSSSPFQMSGGQMRKIAIVSILAMDPQVIILDEPTAGLDPNS
KHQVMSLIKKIQIEENKTIILVSHDMDDVARYSDEVVVMNKGTIVEKSNPRNLFNQKTQL
LKWHIELPKVVKLQKDIEKKYNMLFPKLAMNEEEFVKLYKEWHHEE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagtatacaatttaatcaagtgagttatatttatcaacaagggacaccttatgaattt
gaagctattaaaaacgtttcactaactcttgaacagggcaagtattatgcaattattggt
caaactggaagtgggaaatccactctgattcaacatttgaatgctttattaaagcccact
acaggttcagtcaacattaatggtttagaagttacaaataaaactaaagacaagcactta
cgtcacataagaaaagaagtaggtatagtatttcaatttccagaatcccaattatttgaa
gatagcgttgaaaaagaaattgagtttggacctaaaaattttaatatgaacctaaaaaat
gttaaagacaaagcttttcaacttcttcttgaattaggtttttcaagaaatgtgatgtca
tcctctccatttcaaatgtcgggaggacaaatgagaaaaatagccattgtttccattttg
gctatggatccacaagtaattattctggatgaaccgactgctgggttagacccgaatagt
aaacaccaagtcatgtctttaataaagaaaatacaaatagaagaaaataaaacgattatt
cttgtttcacatgatatggatgatgtagcacgttattcagatgaagttgtagtaatgaat
aaagggacgatagtagaaaaatcaaatcctagaaatttatttaatcaaaaaacgcaatta
ttaaagtggcatatagagttgcctaaagtagtgaagttacagaaagatatcgaaaaaaaa
tataatatgttatttccaaagcttgccatgaatgaagaagagtttgtgaagttgtataag
gagtggcatcatgaagaataa

DBGET integrated database retrieval system