KEGG   Staphylococcus epidermidis RP62A: SERP1859Help
Entry
SERP1859          CDS       T00229                                 

Gene name
modC
Definition
molybdenum ABC transporter ATP-binding protein ModC
Orthology
K02017  
molybdate transport system ATP-binding protein [EC:3.6.3.29]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Molybdate transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP1859 (modC)
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.29  molybdate-transporting ATPase
     SERP1859 (modC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886193..1886813)
Genome map
AA seq 206 aa AA seqDB search
MLTIKVNGVLNQTKININIKDQHPKIYAIQGPSGIGKTTILNIIAGLKAINYSYIKVGKR
VLTDSRHHLNVKVQQRRIGYLFQDYQLFPNMNVYNNITFMTKPSEHINELIHTLKIEHLL
EKYPVTLSGGEAQRVALARALSTKPDLILLDEPFSSLDDKTKNEGIKLILKIFEAWQIPI
IFVTHSNYEAQQMAHEIITIEDCIQI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctcacaattaaagtgaatggtgttcttaatcagacgaaaattaatataaatataaag
gatcaacaccctaagatatatgcgatacagggaccatctggaattggaaagacaacaatt
ttaaatataattgccggtttgaaagctataaattattcatatataaaggttggtaaacgt
gtattaactgattcacgacaccatttgaatgttaaggttcaacaacgtcgtataggatat
ctatttcaagattatcaacttttccccaatatgaatgtttataacaacataacgtttatg
actaaaccttctgaacatatcaatgaacttattcatactctaaaaatagagcatttactt
gaaaagtatcctgtgaccttatcaggaggtgaagctcagcgcgtcgctttagcaagggcg
ctaagtacgaaacccgatttgattttgcttgatgagcctttttcaagtttagatgataaa
acaaaaaacgaaggtatcaaattaattttaaaaatattcgaagcatggcaaattcctatt
atatttgtaacgcattcaaattatgaagcgcaacaaatggcgcatgagattataacaatt
gaagattgtatacaaatatag

DBGET integrated database retrieval system