KEGG   Staphylococcus epidermidis RP62A: SERP1860Help
Entry
SERP1860          CDS       T00229                                 

Gene name
modB
Definition
molybdenum ABC transporter permease ModB
Orthology
K02018  
molybdate transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Molybdate transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP1860 (modB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886814..1887485)
Genome map
AA seq 223 aa AA seqDB search
MPDLTSFWISFRVALISTMIVTIFGILISKWLYNKKRYWVNLLESFIILPIVLPPTVLGF
ILLIIFSTRSPVGEFFTNILHLPVVFTLTGAVIASVIVSFPLMYQHTVNGFRSIDSKMLN
TARTMGASETKIFLKLVLPLSKRSILAGIMMSFARAIGEFGATLMVAGYIPDKTNTLPLE
IYFLVEQGKENEAWLWVLVLVAFAVTVIATINLVNRDTFREVD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatttaacgtccttttggatttcttttcgtgttgctttaatcagtacaatgata
gttactatttttggcattttgatttctaaatggctatacaataaaaaaagatattgggta
aatctattagaaagttttatcattttaccaattgtgttaccacctactgtccttggtttt
atactattaattatattttcaacaagaagtcctgtaggagaattctttactaatatctta
cacttaccagttgtatttacattgacaggtgcagtgattgcatctgtcattgttagtttt
ccccttatgtatcaacatacagtgaatggttttcgaagtatagattcaaagatgttaaat
actgcaagaacgatgggagcaagtgaaacaaaaatatttcttaaattggtgttaccatta
tctaaacgttctattcttgcaggtattatgatgagctttgcaagagcaataggtgaattt
ggtgctactttgatggttgctggctatatcccagacaaaacaaatacattgcctttagaa
atttattttttagtggagcaagggaaagaaaatgaagcatggttatgggtgcttgtatta
gttgcgtttgcggtaactgtcatagcgaccataaatctggttaatcgtgatacgtttagg
gaggttgattaa

DBGET integrated database retrieval system