KEGG   Staphylococcus epidermidis RP62A: SERP1878Help
Entry
SERP1878          CDS       T00229                                 

Gene name
sarY
Definition
accessory regulator Y
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1901119..1901847)
Genome map
AA seq 242 aa AA seqDB search
MQQQKIKRFLAHFVLDHVTIEYLKYGHQLTIEQLKLLIFILHFTENHKEDLSLNMIIFYK
NYQKNQLLKSITHLYEFNWISKKRHPYDQRRLVITLTQNQCSKITQLIEELEHFLEVKST
LINEINHSTLLSYYLKCHSQFRVIEQSCTSQHLTLEELYLLGLLIISDNKTTFKSIKVHA
LKGIIAMGPIIKTLQSKGYLIKSRSRDDERYIVLTLRKEKVNVIQSEIEECYNKLEQGIQ
HV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaacagaagattaaacgattcttagcccattttgtattagatcacgtcacaata
gaatatttgaaatatggccaccagttgacaattgaacagcttaaattattaatatttata
ttacatttcactgaaaatcataaagaagatttaagtttaaatatgatcatcttttacaaa
aattatcaaaaaaaccaattgttaaaaagtattacacatctatatgaatttaattggatt
tcaaaaaaacgacatccatacgaccaacgtagactagttattacattaactcaaaatcaa
tgtagtaaaataactcaattaattgaagaattagaacacttcttagaggtgaaatctaca
ttaataaacgaaattaatcattcaactttattatcgtattatttaaagtgccatagtcaa
tttagagtgattgaacaatcttgcacctctcaacatttaacattagaagaattatacctt
cttgggttacttatcattagtgataacaagactacatttaaaagcataaaagtacatgct
ttaaagggaatcattgcaatgggacctattattaagaccttacagtcaaaaggttatctc
attaaaagtcggagtagagatgatgaacgctatattgtattaacacttagaaaagaaaaa
gttaatgtgattcagtcagaaatcgaggaatgttacaataaattagaacagggaatacag
catgtgtaa

DBGET integrated database retrieval system