KEGG   Staphylococcus epidermidis RP62A: SERP1880Help
Entry
SERP1880          CDS       T00229                                 

Definition
secretory antigen precursor SsaA
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1904431..1905204
Genome map
AA seq 257 aa AA seqDB search
MKKIATATIATAGIATFAFAHHDAQAAEQNNDGYNPNDPYSYSYTYTIDAEGNYHYTWKG
NWSPDRVNTSYNYNNYNNYNYYGYNNYSNYNNYSNYNNYNNYQSNNTQSQRTTQPTGGLG
ASYSTSSSNVHVTTTSAPSSNGVSLSNARSASGNLYTSGQCTYYVFDRVGGKIGSTWGNA
NNWANAAARSGYTVNNSPAKGAILQTSQGAYGHVAYVEGVNSNGSIRVSEMNYGHGAGVV
TSRTISASQAASYNYIH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgctacagctacaattgcaactgcaggaatcgctactttcgcatttgca
caccatgacgcacaagcagcagaacaaaataatgatgggtacaatccaaacgacccttat
tcatatagctacacttacacaatcgatgctgaaggtaactaccactacacttggaaaggt
aactggagtccagatcgtgtaaatacttcatataactataataattataataactacaac
tactatggttacaataactatagcaactacaataactacagtaattacaacaattacaac
aactatcaatcaaacaacacgcaatcacaaagaacaactcaaccgactggtggtttaggc
gcaagctattcaacatcaagtagtaatgttcacgttacaacaacttctgcgccatcatca
aacggtgtatctttatcaaacgctcgctcagcatctggtaacttatacacttcaggtcaa
tgtacatattatgtatttgacagagtaggtggcaaaatcggttcaacgtggggtaacgca
aacaactgggcaaacgctgcagcacgttctggttacacagtaaacaattcacctgctaaa
ggtgcaatcttacaaacgtcacaaggtgcatacggacacgtagcatacgttgaaggtgta
aacagcaatggttcaatcagagtttcagaaatgaactacggtcacggtgcaggtgttgtc
acttcacgtacaatctctgcgagtcaagctgcttcatataactatattcactaa

DBGET integrated database retrieval system