KEGG   Staphylococcus epidermidis RP62A: SERP1894Help
Entry
SERP1894          CDS       T00229                                 

Definition
inositol monophosphatase
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916183..1916998)
Genome map
AA seq 271 aa AA seqDB search
MTELYLKKLDEYICQWIRGLDNIIPRLVEKMETSTKKDRFDLVTNVDKQIQNHFQNFLQE
HYPTHQLLAEEKDNSDITPYEGHLWIMDPIDGTSNLVKQQEDYCIIIGYFIDGEPKLSYI
YDYPHQRLYRAIAGIGAYENNQLMTMPKRIGLREAIISFKPQVLKEETVQSLFQSAFDFR
SIGSCGLDSIRVIKGQFGAHINTNPKPWDISAQFLFVRELGLIMTQINGEPLDFSKAGPF
IISNPGCYDDMIRILNEGRGYSKSSHHIERG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactttatttaaaaaaattagatgaatacatatgtcaatggatacgtggttta
gacaatatcattccacgtttggttgagaaaatggaaacatcaacaaaaaaagataggttt
gatttagttactaatgttgataaacaaattcagaatcattttcaaaactttcttcaggaa
cattatcctacacatcaattactagctgaagagaaagataactcagatataacaccttac
gagggtcacctctggattatggatcctatagatggaacaagtaatttagtgaaacaacaa
gaagattactgtatcataataggatattttattgatggggaacctaaactttcatatatt
tatgattatccacatcaaagattatatagagcaattgctggtataggagcctacgaaaac
aatcaattaatgacaatgccaaaaagaattggtttaagagaggcaattatttcatttaaa
ccacaagtgttaaaagaagagacggttcaatctttatttcaatcagcctttgattttaga
agtattgggtcttgtggtcttgattctattcgagtgataaaaggtcagtttggggcacac
attaatacgaatcctaagccatgggatatttcagcacaatttctttttgtaagagaacta
ggtttgattatgacacaaataaatggtgaacctcttgattttagtaaggcgggcccattt
attattagtaatcctggttgttacgatgatatgatacgtatcttaaatgaaggcagaggc
tattcaaagagtagtcatcatatcgagcgtggttaa

DBGET integrated database retrieval system