KEGG   Staphylococcus epidermidis RP62A: SERP1951Help
Entry
SERP1951          CDS       T00229                                 

Definition
ABC transporter ATP-binding protein
Orthology
K09814  
hemin transport system ATP-binding protein [EC:3.6.3.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Hemin transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP1951
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SERP1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1966538..1967206)
Genome map
AA seq 222 aa AA seqDB search
MGLVVKDISKTFGEKTSKTEVLKDINFEVKDGEFIILNGASGSGKTTLLTILGGLLSQTS
GDVVYEGKSLFERHTNKAHLRLNDIGFIFQASHLVPYLKVLDQLTLIGKETGMSSKEAQA
RAKELLTKIGLEEQLNSYPHMLSGGQQQRVAIMRALMNHPKIVLADEPTASLDASRAQEV
VEMIRKQIKANQMIGIMITHDESLFKYADRIVQLYDGKIKNS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgggtttagttgttaaagatataagtaaaacttttggagaaaaaacctcaaaaacagag
gtgttaaaagatattaactttgaagtgaaagatggagaattcatcattttaaatggtgct
tcaggatcaggaaaaacaaccttattaactattttaggtggtttgttatctcaaacatca
ggtgatgtagtatacgaggggaaatccttatttgaacgacatactaataaagcgcactta
agactaaatgatattggttttatctttcaagcctctcatttagttccatacttaaaagtt
ttagaccaactaaccttaataggtaaagaaactggaatgtctagcaaagaagctcaagca
agagctaaagaattattaacaaaaattggattagaagagcaacttaatagctacccacat
atgctttcaggtggacaacaacaacgtgtagcgattatgagagcacttatgaatcatccg
aaaattgttttagcagatgaacccacagcaagtcttgatgctagtcgtgctcaagaggtt
gttgaaatgatcagaaaacaaataaaagctaaccaaatgataggtatcatgattactcat
gatgaaagcttgttcaaatacgctgatcgtattgttcaattgtacgatggtaaaataaaa
aacagttaa

DBGET integrated database retrieval system