KEGG   Staphylococcus epidermidis RP62A: SERP1954Help
Entry
SERP1954          CDS       T00229                                 

Definition
sensor histidine kinase
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1969057..1970412
Genome map
AA seq 451 aa AA seqDB search
MFKTLYSRIAIYAITVILFSALMSFLFTNIYYHFHLKASNDAKIMRTLKEAREYERTQKP
KPLDTYLKHLGQMNYQIMTVNEHGTKHFYGETFRKNTISQSAIKKVLNGEDYHGIKNKPY
AFFVTGFFDNETDNTVGIQFKTDDGALAVFMRPDIGETFSEFRIFLAVLITLLLIISISL
VIASTYSIIKPVTALKNATTRIMKGDFSTPIKQTRHDEIGTLQSRFNTMRQNLGQVDQMR
QHFVQNVSHEVKTPLTHLQRLLTQLELTQNEEEKQLCINEMFEITNQVSELTKELLLLSE
LDNASHLTFNDNVHLNTLIKDIIRHEQFRTDEKDLVMFTELEDLYFRGNERLLHQAFNNL
IINAMNYAPQNSMINITLTSTNHLIIFNIENDGSIAEEDAKHIFDRFYKLSDESSSNGLG
LAITQSIIHLHHGSITLTSDDKTQFIVKLFI
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaacattatattcgagaattgctatatatgcaattacagtcattttgtttagt
gcattaatgagttttctttttacgaatatttattatcactttcatttgaaagcttctaat
gatgcaaaaattatgcgcacactcaaagaagctcgtgaatatgaaagaacacaaaaacct
aaacctctagatacgtatttgaaacatttaggtcaaatgaattatcaaattatgactgtc
aacgaacatggaaccaaacatttttatggggaaacttttcgtaaaaatactataagtcag
tctgcaatcaaaaaagtgctcaacggtgaagattatcatggtattaaaaataaaccttat
gcattttttgtaacagggttcttcgataatgaaacggataatacagtaggtattcaattt
aaaacagatgatggggcattagcagtttttatgcgcccagatatcggggaaacttttagc
gaatttagaattttcttagctgtgttgataacacttttacttattatttcaatttcacta
gtcattgcatcaacatattctattattaaaccagtgaccgcattaaaaaatgcaacaact
cgaattatgaaaggtgatttcagtacgcctatcaaacaaacacgtcacgatgaaatcgga
acactgcaatcacgtttcaatacaatgcgtcaaaatttaggacaagtagatcaaatgaga
caacattttgtccaaaatgtatctcatgaagttaaaacaccgcttacacatttacaacga
ttgcttacacaacttgaattgacgcaaaatgaagaagagaaacaactatgtatcaatgaa
atgtttgaaatcactaatcaagtaagtgaactaactaaggaattgctacttttatctgaa
ttagataatgcttcccaccttacttttaacgataatgttcatttaaatactttaataaag
gatattattagacatgaacaatttcgaactgatgaaaaagatttagttatgtttactgaa
ttagaagatttgtatttccgaggaaatgaaagactattacatcaagctttcaataacctc
atcattaatgcaatgaattatgctcctcaaaatagcatgattaatatcactctaactagt
acaaatcacttgattatatttaatattgaaaatgatggatcgattgcagaagaagatgcg
aaacatatcttcgatcgtttttataaactgagtgacgaatctagtagtaatggtctaggt
ctagccattacccaatcaatcattcatcttcatcatggtagcattactctcacttcagat
gataaaacacaatttattgtaaaactatttatttag

DBGET integrated database retrieval system