KEGG   Staphylococcus epidermidis RP62A: SERP1958Help
Entry
SERP1958          CDS       T00229                                 

Definition
TagF domain-containing protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975667..1977346
Genome map
AA seq 559 aa AA seqDB search
MIKQINISNMDKLKEQMERALSDGYTHVIPYSNEIQIHQSMIKAITLPKTSFIVDYTINN
YYLNDCKYFGLDFVDFEDWVKNINLYPNVIYEINSTLELIDKFEVENIFDLALLTILKGH
IAVEGHVVLDFKGPLKTSKGFWRSFDRNDLTYRDKFFLNTIAYAHKQRIPFTRVPFNDHD
SIRYYDSVLLSTKFKAPRWLVTPIKNYSVKKHKEISYIYKKDSSKLKNHVVFLGFDFGYR
GNSKYLFNYFVKHNPMIESYFITDERTGPHFISTNDENVKNLIETATFVITESYIPDDIH
PNGKIIQLWHGTPIKKLFLDSKEPHQNLNIYNYRARKYNKWTQQDYLIVDSEESKTYFES
AFPSQKIDILPVGYPRNNYLLNRINDVGLHKRIFSEINIDPTKRVLLYAPTWKTNSSDDD
IFPINEQLLKHYNVIYKGHVESKNDLVPEGVINPPNNIETQDLIIISDVVLTDYSSIIFD
ALTVDKKGCLYTPNHSQYVEERGVYQDVMDTLKPIWYTDAELLINDLITDSIPQLNNKYT
NKNNQSFEYISKLISNQLK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgataaagcaaataaatatttcaaatatggacaaattaaaagagcaaatggaacgtgca
cttagcgacggctatacgcatgtcatcccctattcaaatgaaattcaaattcatcagtcc
atgattaaagctatcactttacctaagacttcatttatagttgactatacaattaacaat
tattatttaaacgattgtaaatacttcgggttggactttgttgattttgaggactgggtt
aaaaatattaatttatatccaaatgttatttatgaaattaattcaacattagaacttatt
gataaatttgaagttgaaaatatctttgatttagcattattaacaattcttaaagggcat
atcgcagttgaaggtcatgtcgtattagactttaaaggaccattaaaaacgagcaaggga
ttttggcgctcatttgaccgtaatgatttaacttatagagataaattcttcttaaacacc
atcgcttatgcacataaacaaagaatcccatttacgcgtgtaccatttaacgatcacgat
agtattagatattatgattcagtactacttagtactaaatttaaagctccaagatggtta
gtgactcctattaagaattattcagttaaaaaacacaaagagattagctatatttataaa
aaggattcatcaaaacttaagaaccacgtcgtttttctaggatttgatttcggctatcga
ggaaactctaagtatttatttaattactttgttaaacacaatcctatgatagagtcttac
tttataacagatgagagaacaggaccacattttatttcaactaacgatgaaaatgtgaag
aatttgattgaaacagctacttttgtcattacggaaagctatattcctgacgacattcac
cctaatggtaaaatcatccaattatggcatgggacacctattaaaaaactatttttagat
agtaaagagccacaccaaaatttaaatatatataactaccgagctcgaaaatataataaa
tggacacaacaagattatttaattgtagattcagaagaatcaaaaacatactttgaatca
gcgtttcctagtcaaaaaattgatatattacctgtaggatatcctagaaataattattta
ttaaatcgtatcaatgatgtaggtttacataaacgtatatttagtgagataaatatagat
cctactaagcgagtattattatatgccccaacatggaaaacaaattcatctgatgatgat
atatttcctattaatgaacagttattaaaacattataatgtgatctataaaggacacgtc
gagagtaaaaatgacttggttcctgaaggcgtaataaatccgcctaataatattgaaacg
caagacttaattattatttcagatgttgttttaacagactactcatcaattatttttgat
gctttaaccgtagataaaaaaggttgcttatacacacccaatcactctcaatatgtcgaa
gaacgtggcgtctatcaagacgtaatggacaccttaaaacctatttggtataccgatgct
gaactattaataaatgatttaattactgatagcatcccacaattaaacaataaatataca
aataaaaataatcagtcatttgaatatattagtaaacttatttcaaatcaattgaaataa

DBGET integrated database retrieval system