KEGG   Staphylococcus epidermidis RP62A: SERP1960Help
Entry
SERP1960          CDS       T00229                                 

Gene name
tagF
Definition
teichoic acid biosynthesis protein F
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1978254..1980419)
Genome map
AA seq 721 aa AA seqDB search
MNKLTIIVTYYNAEEYITGCLESIKQQRTQDFNLIIVNDGSTDQSKKLMDEAIKDYDKNI
RFIDLDENSGHAHARNIALEEVETPYFMFLDADDELASYAITFYLEKFNNTDGLIAPIHS
FTTQRPQFVDLDRVRVEYFNAKENINSFLRKQSACNIIFRTAIVRAHHIRFNENLNTYVD
WSFVLEYMKYVNKFVRIFNFPFYFRGEVYDPFETLTLSEQNFDILFKDYVNSFYDAIKRA
TNPKVREFIVTKMGNKIANEFEPTRYDINERYQTHKDTLVELSKFLHVHLVKNQKLINKI
ETILLMNNETDKAFKVNQFRKTLRHVKNIVLRRKNKERSLYDLTDKEDNVKPKTIVFESF
GGKNYSDSPKYIYEYMQKYYPNYRYIWSFKNPDKNVVPGSAEKVKRNSAEYYQAYSEASH
WVSNARTPLYLNKKENQTYIQTWHGTPLKRLANDMKVVRMPGTTTPKYKRNFNRETSRWD
YLISPNRYSTEIFRSAFWMDEERILEIGYPRNDVLVNRANDQEYLDEIRTHLNLPSDKKV
IMYAPTWRDDEFVSKGKYLFELKIDLDNLYKELGDDYVILLRMHYLISNALDLSGYENFA
IDVSNYNDVSELFLISDCLITDYSSVMFDYGILKRPQFFFAYDIDKYDKGLRGFYMNYME
DLPGPIYTEPYGLAKELKNLDKVQQQYQEKIDAFYDRFCSVDNGKASQYIGDLIHKDIKE
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactgacaattattgtcacgtattataatgcggaggaatacatcacaggttgc
ttagagagtattaagcaacaacgtacacaagattttaatttgattattgtgaatgatggg
tcgacagaccaaagtaaaaaattaatggatgaagctattaaagactatgataaaaacatt
cgatttatcgatttagatgaaaatagtggtcatgcacatgcgcgtaatattgcattagaa
gaagtagaaacaccttactttatgtttttagatgcagatgatgaattagcttcttatgca
atcacgttttacttagaaaagtttaataatactgatggtttaattgctccaatacattct
tttactacacaacgtccgcaatttgttgatttagatcgagtaagggttgaatactttaat
gccaaagagaatattaattcatttttaagaaaacagtcagcttgtaacattatttttaga
acagctattgtcagggcgcatcatattcgatttaatgaaaatttaaatacatatgtggat
tggtcatttgttcttgaatatatgaagtatgtaaataagtttgtacgtatttttaacttc
ccattttatttccgtggggaagtctatgatccatttgaaacacttacattaagtgaacaa
aattttgatattttatttaaagattacgtcaacagcttttatgatgccattaaacgagca
acaaatccaaaagttagagaatttattgtcactaaaatgggaaataaaattgctaatgaa
tttgaaccaactcgatatgatattaatgaacgctatcaaacacataaggatacgcttgtt
gaattatcgaaatttttacatgtacatttagttaaaaaccaaaagctaataaataaaatt
gaaacaattttgttaatgaataatgaaactgataaagcttttaaagttaatcaatttaga
aaaacgttgcgacatgttaaaaatattgttctaagaagaaaaaataaagaacgttcattg
tatgatttaacagataaagaagataatgttaaaccgaaaacgattgtctttgaatcgttc
ggtggtaagaattacagtgatagtccaaagtatatttatgaatatatgcaaaagtattat
cctaattatcgctatatatggtcatttaagaatcccgataaaaatgtcgtaccgggtagt
gctgaaaaggttaagcgtaattcagcagagtattatcaagcatactcggaagcaagtcat
tgggtatcaaatgcgcgtacaccactttatttaaataaaaaagaaaatcaaacgtacatt
caaacttggcacggtacaccattaaaacgtttagcgaatgatatgaaagtggtacgtatg
ccgggtactacgacaccaaagtataagcgtaattttaatcgtgaaacatcacgttgggat
tatttaatttcgccaaatagatattcaactgaaatatttagaagtgctttttggatggat
gaagaaagaatattagagataggttatccaagaaatgatgtattagttaatagagccaat
gatcaagagtatttagatgaaattagaactcacttaaatttacctagtgataaaaaggtt
attatgtatgctccgacatggagagacgatgaatttgtgagtaaaggaaaatatttgttt
gaattaaaaattgatttagacaacctttataaagaactcggagatgattatgtgatttta
ttacgcatgcattatctcatttctaacgcacttgatttatctggttatgaaaattttgca
attgatgtttcaaactataatgacgtctctgaattatttttaataagtgattgtttaatt
acagactattcatcagtaatgtttgattatggtattttaaaacgccctcaatttttcttt
gcatatgatatagacaaatatgataagggattacgaggattctatatgaattatatggaa
gatttaccaggacctatttatacagaaccatatggcctagctaaagaactaaagaattta
gataaagtgcaacagcaatatcaagaaaaaatagatgcattttatgatagattttgctct
gtagataatggtaaggcatctcaatatattggggatttaattcataaggatatcaaggaa
caatga

DBGET integrated database retrieval system