KEGG   Staphylococcus epidermidis RP62A: SERP1981Help
Entry
SERP1981          CDS       T00229                                 

Definition
DegU family transcriptional regulator
Orthology
K07696  
two-component system, NarL family, response regulator NreC
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
NreB-NreC (dissimilatory nitrate/nitrite reduction) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP1981
Two-component system [BR:ser02022]
 NarL family
  NreB-NreC
   SERP1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1998976..1999632)
Genome map
AA seq 218 aa AA seqDB search
MKIVIADDHAVVRTGFSMILNYQEDMEVVATAADGVEAYQKVLEHRPDVLILDLSMPPGE
SGLIATSKISESFPDTKILILTMFDDEEYLFHVLKSGAKGYILKNSPDEQLILAVRTVYQ
GETYVDMKLTTSLVNEFVNQSQTDEVSSSSDPFKILSKRELEILPLIAKGYGNKDIAEKL
FVSVKTVEAHKTHIMTKLNLKSKPELVEYALKKKLLEF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagttatagcggatgaccatgcagttgttaggacaggattttcaatgatatta
aattatcaagaagatatggaagttgttgcaactgcagctgacggggttgaagcttatcaa
aaagtgttagaacatcgaccagatgttttaattttagatttgagcatgccgccaggagag
tcaggcttaatcgcaaccagtaaaatttctgaaagttttcctgatactaaaattttaata
cttacgatgtttgatgacgaagaatatttatttcatgtgttaaaaagtggtgctaaagga
tacattttaaaaaattcacctgatgagcaattaatattggccgtacgtacagtatatcaa
ggtgaaacttatgttgatatgaaattgacgacgtctttagtcaatgagtttgtcaatcaa
tcacaaacggatgaagtgtcatcatcttcagatccatttaaaattttatcgaaacgagag
ttagaaatattacctcttatagcaaaaggctatggcaataaagatattgcagaaaagttg
tttgtatcggtgaaaacggtagaggcacataaaacgcatattatgacgaaactaaattta
aagagtaaacctgaattagttgaatatgccttaaagaaaaaattattagaattttaa

DBGET integrated database retrieval system