KEGG   Staphylococcus epidermidis RP62A: SERP1990Help
Entry
SERP1990          CDS       T00229                                 

Gene name
nirB
Definition
nitrite reductase [NAD(P)H], large subunit (EC:1.7.1.4)
Orthology
K00362  
nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:ser00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2009063..2011468)
Genome map
AA seq 801 aa AA seqDB search
MAKQKLVMIGNGMAGLRTIEEILERSQSQFDITIIGKEPYPNYNRIMLSNILQKKMTVED
TIMNPYDWYQENNIELINNDPVEKVDKENKIVTTSKGIEVEYDICIFATGSKAFVLPIPG
SNLPSVIGWRTIDDTNKMIEIAQTKKRAVVIGGGLLGLECARGLLDQGMEVTVLHLADWL
MEMQLDRKAGEMLKADLEKQGMKIELQANSKEIIGDKDVEAIKLADGRVIETDLVVMAVG
IRPYTEVAKDSGLDVNRGIVVNDYMQTSDSHIYAVGECAEHDGKVYGLVAPLYEQGKVLA
DYLTGKETKGYKGSTTFTSLKVSGCDLYSAGQIVEDEDVHGVEIFNSVDNIYKKVYLSQG
QVVGAVLYGDTDDGSRFYNMMKKHETLEDYTLVSLLHKGDEDAGTSIADMSDDETICGCN
GVDKGTIVNAITSKGLTSVDEVTKATKAGNSCGKCKGQIGELLQYTLGDDFIAAKPTGIC
PCTDLTRDQIVTQIRAKNLKSSKEVRHVLDFKDKDGCPKCRPAINYYLNMVYPFEHRDEK
DSRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYNVPLVKVTGSQRVGL
YGLKKEELPQVWKDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
DTPHKFKMGVSGCPRSCVESGVKDFGVISVENGYQIFIGGNGGTDVTVGKLLTTVETEDE
VIQLCGALMQYYRETGVYAERTAPWLERMGFENVKNVLLNQEKQKELYLRIMEAKKAVEN
EPWETIVENKEAQKIFEVEKV
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaaaaacttgtaatgattggtaatggtatggcaggtttaagaacgatagaa
gagattttagaacgttcacaatcacaatttgatattactattattgggaaagaaccttat
ccgaactataacagaattatgttatccaatattttacagaagaaaatgaccgtcgaagat
acaattatgaatccttatgattggtatcaagagaataatattgaacttataaataatgat
ccagtggaaaaagttgataaagaaaacaaaatagttactacttctaaaggtattgaagta
gagtatgacatttgtattttcgctactggatcaaaagcttttgtattacctataccaggt
tcaaatcttcctagtgtcattggatggcgaacaattgatgatacaaataaaatgattgaa
attgcccaaacgaaaaaacgcgcagttgtcattggtggaggtcttctaggcttagagtgt
gccagaggacttctagatcaaggaatggaagtgacagttcttcatttagctgattggctc
atggaaatgcaattggatcgtaaagccggagaaatgcttaaagcggatttagaaaagcaa
ggtatgaagattgaacttcaagcaaattctaaagaaatcattggtgataaagatgttgaa
gctattaaattagctgacggtcgggtgattgaaacagatttagtagttatggctgttggt
atcagaccttatactgaagttgctaaagatagtggattagatgtcaatagaggtattgtt
gtaaatgattatatgcaaacatctgattctcatatttatgcagtcggtgaatgtgccgaa
catgatgggaaagtttatggattggtggcgccactttatgaacaaggcaaagtgctagca
gattatttaactggtaaagaaacaaaaggttataaaggatctactactttcacttcactt
aaagtatctggttgtgatttatatagtgcagggcaaattgttgaagatgaagatgtccat
ggtgtggaaatttttaatagtgtcgacaatatctacaaaaaagtgtatttaagtcagggt
caagtcgttggtgctgtcttgtatggtgatactgatgatggatcacgattttataatatg
atgaaaaaacatgaaacgcttgaagattatacacttgtttctttattgcataaaggtgat
gaagatgcggggacatctattgctgatatgtctgatgatgaaacgatttgtggatgtaat
ggtgttgataaaggaacaatcgtcaatgctattacaagtaaaggtttaacgtctgtagat
gaagtgactaaagcaacaaaagcaggtaattcatgtggtaagtgtaaaggtcaaatcggt
gagttattacaatatacattaggtgacgactttattgctgcaaaaccaacaggtatttgt
ccatgtactgatttaacaagagaccaaattgtaactcaaatcagggctaaaaatctcaaa
tcatcaaaagaagtacgacacgttcttgatttcaaagataaagatggttgtcctaaatgt
cgacctgcaattaattattatttaaatatggtttatccttttgaacatcgagacgaaaaa
gattctcgcttcgctaatgaaagatatcatgcaaatatacaaaatgatggtactttctca
gtgattcctcaaatgcgcggtggtgttacagatgctgaccaactcattcgattaggagaa
gttgctaaaaagtataacgtaccacttgttaaagtaacaggttcgcaacgtgtaggttta
tatggattgaagaaagaagaattaccacaagtttggaaagatttaggaatgcgttctgct
tctgcttatggtaaaaagacgcgttctgttaaaagttgcgttggtaaagagttttgtcgt
tttggtacacaatacacaactcgactaggaataagacttgaaaaaacatttgaatatatt
gatacacctcataaatttaaaatgggagtatcaggttgtccgagaagttgtgtagagtct
ggtgttaaagattttggcgtcatatctgttgaaaatggctaccaaatatttatcggaggt
aatggtggtactgatgttactgtaggtaaattgttaacgacagttgaaaccgaagatgaa
gtgattcaattatgtggtgccctcatgcagtattacagagaaacaggtgtttacgctgaa
agaacagcaccatggttagaacgtatgggctttgaaaatgtcaagaatgtcttattaaat
caagaaaagcaaaaagaactgtatttaagaattatggaagccaaaaaagctgttgagaat
gaaccatgggaaactattgttgaaaataaagaagcacaaaaaatctttgaagttgagaag
gtgtaa

DBGET integrated database retrieval system