KEGG   Staphylococcus epidermidis RP62A: SERP1990Help
Entry
SERP1990          CDS       T00229                                 

Gene name
nirB
Definition
(GenBank) nitrite reductase [NAD(P)H], large subunit
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00910  Nitrogen metabolism
ser01120  Microbial metabolism in diverse environments
Module
ser_M00530  Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SERP1990 (nirB)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     SERP1990 (nirB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer2_BFD NIR_SIR Pyr_redox Pyr_redox_3 NIR_SIR_ferr NAD_binding_7 NAD_binding_9 DAO HI0933_like NAD_binding_8 AlaDh_PNT_C 3HCDH_N RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AAW52910
UniProt: Q5HLJ7
Position
complement(2009063..2011468)
Genome map
AA seq 801 aa AA seqDB search
MAKQKLVMIGNGMAGLRTIEEILERSQSQFDITIIGKEPYPNYNRIMLSNILQKKMTVED
TIMNPYDWYQENNIELINNDPVEKVDKENKIVTTSKGIEVEYDICIFATGSKAFVLPIPG
SNLPSVIGWRTIDDTNKMIEIAQTKKRAVVIGGGLLGLECARGLLDQGMEVTVLHLADWL
MEMQLDRKAGEMLKADLEKQGMKIELQANSKEIIGDKDVEAIKLADGRVIETDLVVMAVG
IRPYTEVAKDSGLDVNRGIVVNDYMQTSDSHIYAVGECAEHDGKVYGLVAPLYEQGKVLA
DYLTGKETKGYKGSTTFTSLKVSGCDLYSAGQIVEDEDVHGVEIFNSVDNIYKKVYLSQG
QVVGAVLYGDTDDGSRFYNMMKKHETLEDYTLVSLLHKGDEDAGTSIADMSDDETICGCN
GVDKGTIVNAITSKGLTSVDEVTKATKAGNSCGKCKGQIGELLQYTLGDDFIAAKPTGIC
PCTDLTRDQIVTQIRAKNLKSSKEVRHVLDFKDKDGCPKCRPAINYYLNMVYPFEHRDEK
DSRFANERYHANIQNDGTFSVIPQMRGGVTDADQLIRLGEVAKKYNVPLVKVTGSQRVGL
YGLKKEELPQVWKDLGMRSASAYGKKTRSVKSCVGKEFCRFGTQYTTRLGIRLEKTFEYI
DTPHKFKMGVSGCPRSCVESGVKDFGVISVENGYQIFIGGNGGTDVTVGKLLTTVETEDE
VIQLCGALMQYYRETGVYAERTAPWLERMGFENVKNVLLNQEKQKELYLRIMEAKKAVEN
EPWETIVENKEAQKIFEVEKV
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacaaaaacttgtaatgattggtaatggtatggcaggtttaagaacgatagaa
gagattttagaacgttcacaatcacaatttgatattactattattgggaaagaaccttat
ccgaactataacagaattatgttatccaatattttacagaagaaaatgaccgtcgaagat
acaattatgaatccttatgattggtatcaagagaataatattgaacttataaataatgat
ccagtggaaaaagttgataaagaaaacaaaatagttactacttctaaaggtattgaagta
gagtatgacatttgtattttcgctactggatcaaaagcttttgtattacctataccaggt
tcaaatcttcctagtgtcattggatggcgaacaattgatgatacaaataaaatgattgaa
attgcccaaacgaaaaaacgcgcagttgtcattggtggaggtcttctaggcttagagtgt
gccagaggacttctagatcaaggaatggaagtgacagttcttcatttagctgattggctc
atggaaatgcaattggatcgtaaagccggagaaatgcttaaagcggatttagaaaagcaa
ggtatgaagattgaacttcaagcaaattctaaagaaatcattggtgataaagatgttgaa
gctattaaattagctgacggtcgggtgattgaaacagatttagtagttatggctgttggt
atcagaccttatactgaagttgctaaagatagtggattagatgtcaatagaggtattgtt
gtaaatgattatatgcaaacatctgattctcatatttatgcagtcggtgaatgtgccgaa
catgatgggaaagtttatggattggtggcgccactttatgaacaaggcaaagtgctagca
gattatttaactggtaaagaaacaaaaggttataaaggatctactactttcacttcactt
aaagtatctggttgtgatttatatagtgcagggcaaattgttgaagatgaagatgtccat
ggtgtggaaatttttaatagtgtcgacaatatctacaaaaaagtgtatttaagtcagggt
caagtcgttggtgctgtcttgtatggtgatactgatgatggatcacgattttataatatg
atgaaaaaacatgaaacgcttgaagattatacacttgtttctttattgcataaaggtgat
gaagatgcggggacatctattgctgatatgtctgatgatgaaacgatttgtggatgtaat
ggtgttgataaaggaacaatcgtcaatgctattacaagtaaaggtttaacgtctgtagat
gaagtgactaaagcaacaaaagcaggtaattcatgtggtaagtgtaaaggtcaaatcggt
gagttattacaatatacattaggtgacgactttattgctgcaaaaccaacaggtatttgt
ccatgtactgatttaacaagagaccaaattgtaactcaaatcagggctaaaaatctcaaa
tcatcaaaagaagtacgacacgttcttgatttcaaagataaagatggttgtcctaaatgt
cgacctgcaattaattattatttaaatatggtttatccttttgaacatcgagacgaaaaa
gattctcgcttcgctaatgaaagatatcatgcaaatatacaaaatgatggtactttctca
gtgattcctcaaatgcgcggtggtgttacagatgctgaccaactcattcgattaggagaa
gttgctaaaaagtataacgtaccacttgttaaagtaacaggttcgcaacgtgtaggttta
tatggattgaagaaagaagaattaccacaagtttggaaagatttaggaatgcgttctgct
tctgcttatggtaaaaagacgcgttctgttaaaagttgcgttggtaaagagttttgtcgt
tttggtacacaatacacaactcgactaggaataagacttgaaaaaacatttgaatatatt
gatacacctcataaatttaaaatgggagtatcaggttgtccgagaagttgtgtagagtct
ggtgttaaagattttggcgtcatatctgttgaaaatggctaccaaatatttatcggaggt
aatggtggtactgatgttactgtaggtaaattgttaacgacagttgaaaccgaagatgaa
gtgattcaattatgtggtgccctcatgcagtattacagagaaacaggtgtttacgctgaa
agaacagcaccatggttagaacgtatgggctttgaaaatgtcaagaatgtcttattaaat
caagaaaagcaaaaagaactgtatttaagaattatggaagccaaaaaagctgttgagaat
gaaccatgggaaactattgttgaaaataaagaagcacaaaaaatctttgaagttgagaag
gtgtaa

DBGET integrated database retrieval system