KEGG   Staphylococcus epidermidis RP62A: SERP1994Help
Entry
SERP1994          CDS       T00229                                 

Definition
ABC transporter substrate-binding protein
Orthology
K02035  
peptide/nickel transport system substrate-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
Peptides/nickel transport system
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2012875..2014350
Genome map
AA seq 491 aa AA seqDB search
MKKLITLIVMISFVLASCGGTSSTDKDTLNVEIPLKTKSIAPYETDIPVKTGALESLFKM
SKNGKVKPLLVKNYHQVSDNQLELTLKDNIKFQNGHHLTGEAVKRSLEEGMKKSDLLKGS
LPIKSINAHGQKVTITTKEPYPELMSELASPFAAIYDTKAKNKVTDQPVGTGPYKIDQYK
RSQKIVLKQFKDYWQGTPKLKRINVTYHEDGNTRVDHLLSGKSDLTTDVPIERVDDVKKS
NKANIQSTSGFRTHLMLYNHDSKKVNKKVREALDMIINRKDIAKNVSKNYAEPASGPFNH
RLKSLEKEEIQSQDIKRAKELLAQEGYSKSHPLKLNMVTYDGRPELPKIGQVIQSEAKKA
NVDIQLRNVDDIEGYLKNKQSWDVSMYSYLSVPRGDTGYFFNTAYLPDGALNKGNYSNTK
VTQLIKELNTTFGDKQRGQVTNEILNESKKDIPNSYITYNSQIDGVNNKVRHFNVTPESI
YLIDYKLSKKE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgattactcttattgtcatgatatcttttgttttagcgagctgtgggggc
acatcaagtacagacaaagacaccctcaatgttgaaatacctttgaaaactaaatcaatt
gcaccttacgaaactgatatcccagttaaaacaggtgccttggaatcgctttttaaaatg
tcgaagaatggtaaagtaaaacctttattagtcaaaaattatcatcaagtatctgacaat
caactagaactcactttaaaagataatattaaatttcaaaacggtcatcatttaacaggc
gaagctgtaaaacgcagtctcgaagaaggaatgaaaaaaagtgatttgttaaaaggatca
cttcctattaaatcaatcaatgctcatggacaaaaagtcacaatcactactaaagaacct
tatccagaattaatgtctgaactcgcaagcccatttgctgctatttacgacacaaaagct
aaaaacaaagtaactgatcaacctgttggtacgggtccttataaaattgatcagtataaa
cgttcgcaaaaaatcgtactaaaacaattcaaagactactggcaaggtacgccaaaatta
aaaagaattaatgtcacttatcatgaagatggtaatactcgtgttgatcacttattatca
ggcaaatcagatttgactactgatgttccaattgaacgcgttgatgatgtaaaaaaatct
aacaaagcaaacattcaaagtacatcaggctttagaacgcatttaatgttatacaatcat
gatagtaaaaaagttaataaaaaagtaagagaagcactagatatgattattaatcgaaaa
gacattgctaaaaatgtttctaaaaattatgctgagccagcatcaggtccttttaaccat
cgattaaaatcattagaaaaagaggaaattcaatcacaagacatcaagcgtgcaaaagaa
cttttagctcaagaaggttattccaaatcgcatcctcttaaattaaacatggtcacatac
gatggcagaccagaattgcctaaaattggacaggtgatacaatctgaagctaaaaaggca
aatgttgatatacaattacgcaatgtagatgatatcgaaggatatctcaaaaacaaacag
agttgggatgtttcaatgtatagttatttaagtgtgccacgtggtgatacaggttatttc
tttaacactgcatacttacctgatggagcattaaataaaggtaattatagtaatactaaa
gtcactcagttaattaaagaattaaatactactttcggtgacaagcaacgtggtcaagtg
actaatgaaatactaaatgaatctaaaaaagatattcctaacagctatatcacatacaac
tctcaaatagatggtgtgaataataaagtaagacattttaatgttacaccagaatctatc
tatttaattgattataaattaagtaaaaaagaataa

DBGET integrated database retrieval system