KEGG   Staphylococcus epidermidis RP62A: SERP2003Help
Entry
SERP2003          CDS       T00229                                 

Definition
amino acid ABC transporter ATP-binding protein
Orthology
K10010  
cystine transport system ATP-binding protein [EC:3.6.3.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Cystine transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2021139..2021870)
Genome map
AA seq 243 aa AA seqDB search
MIELSHIHKSFNETEVIKGIDLKVNQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYV
NGMTYNAKDKKSQIKVRQQSGMVFQNYNLFPHKSALENVMEGLITVKKMNKATANEEAMN
LLAKVGLVHVKDQRPHALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVI
KELADEGMTMVIVTHEMRFAKEVSNQIAFIHEGVIAEQGTPEDIFNHPKTEELQRFLNVI
NEK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgattgaattgtctcatatccataagtcttttaatgaaactgaagtgattaaaggtatt
gatttgaaagttaatcaaggtgaagttgtgacactaattggacgttcaggttcaggtaaa
acgactttacttagaatgattaatgctttagagatacctactgaaggtacagtgtatgtc
aatggcatgacatataatgctaaagataagaaatctcaaattaaagtaagacaacaatca
ggaatggtttttcaaaattataatttatttccacataaatctgcattagaaaacgttatg
gaaggtcttataacagttaaaaagatgaataaagcaacggctaatgaagaagcaatgaat
ttattggctaaggttggattggtacatgttaaagatcaacggccacatgctttatcaggt
gggcaacaacaacgtgtcgcaattgcacgtgcattagccatgaatcctaaagtgatgtta
tttgatgagccaacatctgcacttgatcctgaattggtcaatgatgtattaaaagtcatt
aaagaattggctgacgaaggtatgacaatggtcattgtgactcacgagatgcgttttgcc
aaagaagtttccaatcaaattgcttttattcatgagggcgtcattgcagaacaaggtacg
cctgaagatatatttaatcaccccaaaacagaagagcttcagcgatttttaaatgtgatt
aatgaaaaatag

DBGET integrated database retrieval system