KEGG   Staphylococcus epidermidis RP62A: SERP2025Help
Entry
SERP2025          CDS       T00229                                 

Gene name
lytR
Definition
two-component response regulator
Orthology
K07705  
two-component system, LytT family, response regulator LytT
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
LytS-LytR two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ser02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2046131..2046889
Genome map
AA seq 252 aa AA seqDB search
MKALIVDDEPLARNELQYLLNLNDAIDEIEEAENIEETLEKLLYNTFDLIFLDINLMDES
GIDLAQKINKMKRSPHIIFATAHEKFAVKAFELNATDYILKPFEKERINQAVNKVDMAKD
KPKNKDKTITPKYIDYSDDERAQTHVLPIEVDERIHILNFTDIIALSVNNGITTIDTTKQ
SYETTETLNHYEKKLPSSLFIKIHRATIVNKEHIQTIEHWFNYTYQLTLTHEFKYQVSRS
YMKTFKQQLGLQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaatcgttgatgatgaaccacttgcaagaaatgaattacaatatctttta
aatcttaatgatgctatagatgaaattgaagaagcagaaaacatagaagaaacattggag
aagttactctacaacacatttgacttaatattcttagatataaatttaatggatgaaagt
ggtattgatttagctcaaaaaattaataaaatgaagcgatcaccacatattatctttgca
accgctcacgagaaatttgcagtcaaagcctttgaattaaatgcaaccgattatatatta
aaaccttttgaaaaagaacgtattaatcaagctgtaaataaagttgacatggctaaagat
aaaccaaaaaacaaagataaaactatcacacctaaatatattgattatagtgatgatgag
cgcgctcaaacacatgtacttccaattgaagtggatgaacgtattcacatcttaaatttc
acagacattatcgcattatctgttaataatgggattacaacgatagatacaacaaaacaa
agttatgaaacgaccgaaacacttaatcattacgagaaaaaactaccttcctctctattt
attaaaatacatcgcgctactatcgttaataaagaacatatccaaacaatagagcattgg
tttaattatacgtatcagctgacgttaacacatgaatttaaatatcaagttagtcgttct
tatatgaagacttttaaacaacaactcggtcttcaataa

DBGET integrated database retrieval system