KEGG   Staphylococcus epidermidis RP62A: SERP2030Help
Entry
SERP2030          CDS       T00229                                 

Definition
amino acid ABC transporter permease
Orthology
K05846  
osmoprotectant transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Osmoprotectant transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050025..2050660)
Genome map
AA seq 211 aa AA seqDB search
MKAFLQEYGSQLLSKAVEHFYISMFALLLAIVVAVPLGILLSKTQRTANVVLTVAGVLQT
IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVKNIDKNVIQAGQSMGMTKF
QLMKDVEMPLALPLIISGIRLSSVYVISWATLASYVGAGGLGDLVFNGLNLYQPPMIISA
AIVVTLLALVIDFILSLVEKWVVPKGLKVSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattcttacaagaatacggtagtcaacttttatcaaaagcagtagaacatttt
tatatttctatgtttgcattattgttagcgattgtagtagctgtccctttaggtatttta
ttatcaaaaacgcaacgcacagctaatgtggtattaacagttgctggcgtgcttcaaacc
attcctactttggctgtgttagctatcatgattccaatatttggggtaggaaaaacacca
gctattgttgcattatttatctatgtattattaccaattttaaataatacagtattaggt
gttaaaaatatcgataaaaatgtcattcaagctggtcaaagtatgggaatgactaaattt
caattaatgaaagatgtagaaatgcctttagctttaccacttattattagtggtattcgt
ctatcaagtgtatacgtcattagttgggcaacactcgcaagttatgtaggtgcaggtgga
cttggggatcttgtatttaatggattaaatctctatcaaccacctatgattattagtgca
gcgattgttgttactttattagcattagttattgactttatactttcattagttgaaaaa
tgggttgtacctaaaggattaaaagtatctagataa

DBGET integrated database retrieval system