KEGG   Staphylococcus epidermidis RP62A: SERP2030Help
Entry
SERP2030          CDS       T00229                                 

Definition
(GenBank) amino acid ABC transporter, permease protein
  KO
K05846  osmoprotectant transport system permease protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
Module
ser_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2030
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    SERP2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4229
Motif
Other DBs
NCBI-ProteinID: AAW52856
UniProt: Q5HLF7
Position
complement(2050025..2050660)
Genome map
AA seq 211 aa AA seqDB search
MKAFLQEYGSQLLSKAVEHFYISMFALLLAIVVAVPLGILLSKTQRTANVVLTVAGVLQT
IPTLAVLAIMIPIFGVGKTPAIVALFIYVLLPILNNTVLGVKNIDKNVIQAGQSMGMTKF
QLMKDVEMPLALPLIISGIRLSSVYVISWATLASYVGAGGLGDLVFNGLNLYQPPMIISA
AIVVTLLALVIDFILSLVEKWVVPKGLKVSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattcttacaagaatacggtagtcaacttttatcaaaagcagtagaacatttt
tatatttctatgtttgcattattgttagcgattgtagtagctgtccctttaggtatttta
ttatcaaaaacgcaacgcacagctaatgtggtattaacagttgctggcgtgcttcaaacc
attcctactttggctgtgttagctatcatgattccaatatttggggtaggaaaaacacca
gctattgttgcattatttatctatgtattattaccaattttaaataatacagtattaggt
gttaaaaatatcgataaaaatgtcattcaagctggtcaaagtatgggaatgactaaattt
caattaatgaaagatgtagaaatgcctttagctttaccacttattattagtggtattcgt
ctatcaagtgtatacgtcattagttgggcaacactcgcaagttatgtaggtgcaggtgga
cttggggatcttgtatttaatggattaaatctctatcaaccacctatgattattagtgca
gcgattgttgttactttattagcattagttattgactttatactttcattagttgaaaaa
tgggttgtacctaaaggattaaaagtatctagataa

DBGET integrated database retrieval system