KEGG   Staphylococcus epidermidis RP62A: SERP2031Help
Entry
SERP2031          CDS       T00229                                 

Definition
amino acid ABC transporter ATP-binding protein
Orthology
K05847  
osmoprotectant transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050663..2051919)
Genome map
AA seq 418 aa AA seqDB search
MLSIKNLTKIYSGNKKAVDNISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATDGQIM
MNGKDVRNMNPVELRRSIGYVIQQIGLMPHMTIRENIVLVPKLLKWSKEKKDEKAKELIK
LVDLPEEYLDRYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKE
LQQKLGKTFIFVTHDMDEAIKLADKICIMSKGKVVQYDTPDNILRYPANDFVRDFIGQNR
LIQDRPNMKSVESAMIKPVTVKADDSLNDAVNIMRTRRVDTIFVVNNQNKLLGFLDIEDI
NQGLRARKELIDTMQRDVYKVHINSKLQDSVRTILKRNVRNVPVVDNDEHLIGLITRANL
VDIVYDSIWGEEDSDSYEIPNESLDENNHDLPQNQTDTRTNINEDVNDYHDAQHRGED
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtattaaaaacttaaccaagatttattcagggaataaaaaagcggtagataat
atttctttggatattcaatctggtgaatttatcgcttttattgggacgagtggtagtggt
aaaacaactgcactacgcatgattaatcgtatgattgaggcgacagatggacagattatg
atgaatggaaaagatgtccgtaatatgaatcctgttgaattgcggagaagtatcggttat
gtcattcaacaaattggtttgatgccacatatgactattcgagaaaatattgttttagta
cctaaacttttaaaatggtctaaagagaagaaagatgaaaaagctaaagaacttattaaa
ctggtagatttacctgaagaatatttggatcgttatccagctgaattgtcaggagggcaa
caacaacgaattggtgttgtgcgcgctttagcagctgaacaagatattatattaatggat
gaacctttcggtgcattagatcctattacacgcgatacattacaagatttagtaaaggaa
ttacaacaaaaattaggaaaaacatttatttttgtcactcatgatatggatgaggctatt
aaattagcagacaaaatatgtattatgtctaagggaaaagtcgttcaatacgatacacct
gacaatattttacgatatcctgcaaatgactttgttagagattttattgggcaaaatcgc
ttgattcaggatcgtcctaatatgaaatctgtggaaagtgctatgatcaaacccgtcact
gttaaagcagatgattcattgaatgatgcagtaaatattatgagaacacgtcgagtagac
actatttttgtagtcaataatcaaaataaattattaggatttttagatattgaagatatc
aatcaaggattacgtgcgcgtaaagaattaattgataccatgcaaagggatgtctacaaa
gtacatatcaattcaaagttacaagactcagtgcgtactattctaaaacgtaatgttaga
aatgtacctgtggtcgataatgatgaacatctcattggtttaattacacgtgcaaactta
gtcgatattgtgtatgactcaatttggggcgaagaagattctgatagttatgagatccca
aatgaaagcttagatgagaataatcacgatttaccacaaaatcaaactgatacacgaaca
aatataaatgaagatgtgaatgattatcatgatgctcaacatagaggtgaggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system