KEGG   Staphylococcus epidermidis RP62A: SERP2038Help
Entry
SERP2038          CDS       T00229                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K02068  putative ABC transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Module
ser_M00211  Putative ABC transport system
Brite
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative ABC transporter [MD:M00211] [OT]
    SERP2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 RsgA_GTPase AAA_15 AAA_18 AAA_16 G-alpha ABC_ATPase AAA_30 NACHT AAA_5 AAA_23 AAA_14 AAA_33 AAA_24 RNA_helicase AAA_28 SbcCD_C AAA_25 Cytidylate_kin NB-ARC PIF1 T2SSE IstB_IS21 MMR_HSR1 AAA Adeno_IVa2 Mg_chelatase ATPase_2 PRK NTPase_1 cobW ATP_bind_1 PSD3 MobB PTPS_related
Motif
Other DBs
NCBI-ProteinID: AAW52870
UniProt: Q5HLE9
Position
complement(2059580..2060242)
Genome map
AA seq 220 aa AA seqDB search
MLLKVEHLTYKVDNRTILDDINLNINKGDTIAIVGPSGSGKSTLLKQLNHLISPTSGDLY
LNDQSYFNYKPEEIRTRVSYLMQQSELIGYTIEDNMKFPAEARSEAFDRDKAKQLISQVG
LGNYQLDAQIEHMSGGEQQRITIARQLMYEPEVLLLDEATSALDTHNKKKIEEIIFKLAD
KGIAILWITHSDDQSMRHFKRRITITDGKISSDEELNGNE
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgctacttaaggttgaacatcttacatacaaggttgataatcgtacgattttagatgat
attaatttgaatattaataaaggagacacgattgctattgtaggtccttctggaagcggt
aagagtactttactcaaacaattgaatcatttaattagtcccacgagtggagatttatat
ttgaatgatcaatcttactttaattataagccggaagagataagaacacgtgtgagttat
ttaatgcaacaaagtgagttaatcggttatacaattgaagataatatgaaatttcctgct
gaggctagaagtgaagcttttgaccgtgataaagcgaaacaactcatctctcaagtagga
ttaggtaattatcagttagatgctcaaattgagcacatgtctgggggagagcaacaacgt
attaccatcgctagacaactcatgtatgaacctgaagttttattattggacgaagctact
agcgctttagatacacataataaaaagaaaattgaagaaattatatttaaactagcagat
aaagggattgccattttgtggattacgcatagtgatgaccaaagtatgcgtcattttaag
cgtagaatcacaattactgacggtaagatatcgagtgatgaggagttgaatggtaatgag
taa

DBGET integrated database retrieval system