KEGG   Staphylococcus epidermidis RP62A: SERP2048Help
Entry
SERP2048          CDS       T00229                                 

Definition
acetylornithine deacetylase (EC:3.5.1.16)
Orthology
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SERP2048
   01230 Biosynthesis of amino acids
    SERP2048
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SERP2048
Enzymes [BR:ser01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     SERP2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2070559..2071815)
Genome map
AA seq 418 aa AA seqDB search
MGYQLDKRQFEILDMLVRFNTESPPGRNTDPLQDEIETLLKQLDFSIQREQLYDNDSVIV
ATLKGHNPKAPKLILNGHVDVASVDDDQYWQYPPFKLTNKDEWLYGRGVSDMKGGMSSLF
YVLEQLHQAGQRPEGDIIVQSVVGEEVGEAGTKRACEIGPKGDLALVLDTSENQALGQGG
VITGWITVKSKNTIHDGARSQTIHAGGGLFGASAIEKMTKVIQSLNELERHWGVMKKSPG
MPPGANTINPAVIEGGRHPAFIADECRLWITVHYLPNESYESVVNEIERYLNKVAEADVW
LRENPLEFEWGGTSMIEDKGEIFPSFTVPTHHPGFKQLEEAHEHIHNKKLEHGMSTTVTD
GGWTAHFGIPTILYGPGSLEEAHSVDEKIKAKELAQYSDVLYTFLKEWYEHPQSYKSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcaattggataaacgtcaatttgaaattttagatatgctagtgagatttaat
actgaaagtccacctggacgtaatacagatccattgcaagatgaaatcgaaacgttactt
aaacaactggatttttcaatacagagagaacagttatatgacaatgatagtgtgatagta
gccaccttaaaagggcacaatcctaaagcgccaaaactgatattgaatggacatgttgat
gtagcttctgtagatgacgatcaatattggcagtatccaccttttaaacttaccaacaaa
gatgaatggttatacggtcgtggcgttagcgatatgaaaggtggtatgtcttcattattc
tacgtcttggagcaattacatcaagcggggcaacgtccagaaggtgatattattgttcaa
tcagtagtcggtgaagaagtaggtgaagcaggaactaaacgtgcatgtgaaataggacct
aaaggtgacttagcccttgtcttagatacgagtgagaatcaagcacttgggcaaggtggc
gtgattaccggatggattacagttaaaagtaaaaatacaatacatgatggtgcgcgtagt
caaacgatacatgctggtgggggcttgtttggtgcaagtgccattgaaaaaatgacaaag
gtgattcaatcgcttaatgaacttgaaaggcattggggtgtcatgaagaagagtcctgga
atgcctccaggtgcgaatacaattaacccagctgtcatagaaggtggacgtcaccctgca
tttattgcagatgaatgtcgattatggattactgttcattacttaccgaacgaaagttat
gaatctgtagttaatgaaatagagcgatatttaaataaggttgcagaagcagatgtatgg
ctcagagagaatccacttgaatttgaatggggtggtacatccatgattgaggataaagga
gaaattttcccaagtttcactgttccgacacatcatccaggttttaagcaattagaagaa
gcacatgaacatattcataataaaaagcttgaacatggtatgagtacaactgtaactgat
ggaggttggacagcacattttggcattcccacgatattatatgggccaggtagtttagaa
gaggcacatagtgtagatgagaaaataaaagcaaaggaattagctcaatatagtgatgtt
ttatatacatttttaaaagaatggtatgaacacccacaatcctataaatcatcatag

DBGET integrated database retrieval system