KEGG   Staphylococcus epidermidis RP62A: SERP2048Help
Entry
SERP2048          CDS       T00229                                 

Definition
(GenBank) peptidase, M20/M25/M40 family
  KO
K20895  
formylaminopyrimidine deformylase [EC:3.5.1.-]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SERP2048
Enzymes [BR:ser01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     SERP2048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2070559..2071815)
Genome map
AA seq 418 aa AA seqDB search
MGYQLDKRQFEILDMLVRFNTESPPGRNTDPLQDEIETLLKQLDFSIQREQLYDNDSVIV
ATLKGHNPKAPKLILNGHVDVASVDDDQYWQYPPFKLTNKDEWLYGRGVSDMKGGMSSLF
YVLEQLHQAGQRPEGDIIVQSVVGEEVGEAGTKRACEIGPKGDLALVLDTSENQALGQGG
VITGWITVKSKNTIHDGARSQTIHAGGGLFGASAIEKMTKVIQSLNELERHWGVMKKSPG
MPPGANTINPAVIEGGRHPAFIADECRLWITVHYLPNESYESVVNEIERYLNKVAEADVW
LRENPLEFEWGGTSMIEDKGEIFPSFTVPTHHPGFKQLEEAHEHIHNKKLEHGMSTTVTD
GGWTAHFGIPTILYGPGSLEEAHSVDEKIKAKELAQYSDVLYTFLKEWYEHPQSYKSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcaattggataaacgtcaatttgaaattttagatatgctagtgagatttaat
actgaaagtccacctggacgtaatacagatccattgcaagatgaaatcgaaacgttactt
aaacaactggatttttcaatacagagagaacagttatatgacaatgatagtgtgatagta
gccaccttaaaagggcacaatcctaaagcgccaaaactgatattgaatggacatgttgat
gtagcttctgtagatgacgatcaatattggcagtatccaccttttaaacttaccaacaaa
gatgaatggttatacggtcgtggcgttagcgatatgaaaggtggtatgtcttcattattc
tacgtcttggagcaattacatcaagcggggcaacgtccagaaggtgatattattgttcaa
tcagtagtcggtgaagaagtaggtgaagcaggaactaaacgtgcatgtgaaataggacct
aaaggtgacttagcccttgtcttagatacgagtgagaatcaagcacttgggcaaggtggc
gtgattaccggatggattacagttaaaagtaaaaatacaatacatgatggtgcgcgtagt
caaacgatacatgctggtgggggcttgtttggtgcaagtgccattgaaaaaatgacaaag
gtgattcaatcgcttaatgaacttgaaaggcattggggtgtcatgaagaagagtcctgga
atgcctccaggtgcgaatacaattaacccagctgtcatagaaggtggacgtcaccctgca
tttattgcagatgaatgtcgattatggattactgttcattacttaccgaacgaaagttat
gaatctgtagttaatgaaatagagcgatatttaaataaggttgcagaagcagatgtatgg
ctcagagagaatccacttgaatttgaatggggtggtacatccatgattgaggataaagga
gaaattttcccaagtttcactgttccgacacatcatccaggttttaagcaattagaagaa
gcacatgaacatattcataataaaaagcttgaacatggtatgagtacaactgtaactgat
ggaggttggacagcacattttggcattcccacgatattatatgggccaggtagtttagaa
gaggcacatagtgtagatgagaaaataaaagcaaaggaattagctcaatatagtgatgtt
ttatatacatttttaaaagaatggtatgaacacccacaatcctataaatcatcatag

DBGET integrated database retrieval system