KEGG   Staphylococcus epidermidis RP62A: SERP2048Help
Entry
SERP2048          CDS       T00229                                 

Definition
acetylornithine deacetylase (EC:3.5.1.16)
Orthology
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ser01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ser01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ser00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2070559..2071815)
Genome map
AA seq 418 aa AA seqDB search
MGYQLDKRQFEILDMLVRFNTESPPGRNTDPLQDEIETLLKQLDFSIQREQLYDNDSVIV
ATLKGHNPKAPKLILNGHVDVASVDDDQYWQYPPFKLTNKDEWLYGRGVSDMKGGMSSLF
YVLEQLHQAGQRPEGDIIVQSVVGEEVGEAGTKRACEIGPKGDLALVLDTSENQALGQGG
VITGWITVKSKNTIHDGARSQTIHAGGGLFGASAIEKMTKVIQSLNELERHWGVMKKSPG
MPPGANTINPAVIEGGRHPAFIADECRLWITVHYLPNESYESVVNEIERYLNKVAEADVW
LRENPLEFEWGGTSMIEDKGEIFPSFTVPTHHPGFKQLEEAHEHIHNKKLEHGMSTTVTD
GGWTAHFGIPTILYGPGSLEEAHSVDEKIKAKELAQYSDVLYTFLKEWYEHPQSYKSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgggatatcaattggataaacgtcaatttgaaattttagatatgctagtgagatttaat
actgaaagtccacctggacgtaatacagatccattgcaagatgaaatcgaaacgttactt
aaacaactggatttttcaatacagagagaacagttatatgacaatgatagtgtgatagta
gccaccttaaaagggcacaatcctaaagcgccaaaactgatattgaatggacatgttgat
gtagcttctgtagatgacgatcaatattggcagtatccaccttttaaacttaccaacaaa
gatgaatggttatacggtcgtggcgttagcgatatgaaaggtggtatgtcttcattattc
tacgtcttggagcaattacatcaagcggggcaacgtccagaaggtgatattattgttcaa
tcagtagtcggtgaagaagtaggtgaagcaggaactaaacgtgcatgtgaaataggacct
aaaggtgacttagcccttgtcttagatacgagtgagaatcaagcacttgggcaaggtggc
gtgattaccggatggattacagttaaaagtaaaaatacaatacatgatggtgcgcgtagt
caaacgatacatgctggtgggggcttgtttggtgcaagtgccattgaaaaaatgacaaag
gtgattcaatcgcttaatgaacttgaaaggcattggggtgtcatgaagaagagtcctgga
atgcctccaggtgcgaatacaattaacccagctgtcatagaaggtggacgtcaccctgca
tttattgcagatgaatgtcgattatggattactgttcattacttaccgaacgaaagttat
gaatctgtagttaatgaaatagagcgatatttaaataaggttgcagaagcagatgtatgg
ctcagagagaatccacttgaatttgaatggggtggtacatccatgattgaggataaagga
gaaattttcccaagtttcactgttccgacacatcatccaggttttaagcaattagaagaa
gcacatgaacatattcataataaaaagcttgaacatggtatgagtacaactgtaactgat
ggaggttggacagcacattttggcattcccacgatattatatgggccaggtagtttagaa
gaggcacatagtgtagatgagaaaataaaagcaaaggaattagctcaatatagtgatgtt
ttatatacatttttaaaagaatggtatgaacacccacaatcctataaatcatcatag

DBGET integrated database retrieval system