KEGG   Staphylococcus epidermidis RP62A: SERP2118Help
Entry
SERP2118          CDS       T00229                                 

Definition
LysR family transcriptional regulator
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2143077..2143961)
Genome map
AA seq 294 aa AA seqDB search
MDIKHMKYFVEVVKQGGMTNASKSLYIAQPTISKAIKDIEAEMAVPLFDRSKRSLVLTDA
GKIFFKKCQEIIALYDNLPTEINSLYGLETGHITISMSAVMSMRKFIGVLGDFHQLYPNI
TYNLIESGGKTTENLILNDEVDIGVTTLPVDHQKFECISLNKEELTVVLNKEHPLAQKSS
IKMEELADENFILFNEDFYLNDKIIENAKNAGFVPNMASQISQWNVIENLVINQLGISIL
PATIAQLLNDDVKIVHLENAHTTWELGVVWKKDKRLSHATNKWIEFLKERLSEE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaacacatgaaatactttgttgaagttgtcaaacaaggtggtatgacaaac
gcttcaaaatccttgtatattgcgcaaccaactatcagtaaagcaattaaggatattgaa
gcagagatggctgtccctttatttgaccggagtaaaagaagtttagtacttactgatgca
ggtaaaatttttttcaagaaatgtcaagaaatcatcgcactatatgataatttgcccact
gaaattaatagtttgtatggtttagaaacaggtcatatcactattagtatgtctgcagtg
atgagcatgcgtaaatttattggcgtattaggagactttcatcaactttatccgaatatt
acgtacaacttaatcgaaagtggtggtaagacgactgaaaaccttatacttaatgatgaa
gtggatattggtgtgacaacattgccagtagatcatcaaaaatttgaatgtatatcttta
aacaaagaagaactgactgtagttttaaataaagaacatcctttagcacaaaaatcttct
attaaaatggaagaattagctgatgagaacttcattttatttaatgaagatttctatctc
aacgataaaattattgaaaatgcgaagaatgctggattcgtgccgaacatggcctcacaa
atctcacaatggaatgtgattgaaaatcttgtcattaatcaattaggtatttccatattg
ccagccactatagcacaattacttaatgatgacgtcaaaattgtacatttggaaaatgca
catacaacttgggagcttggtgtcgtttggaaaaaagataaacgtttaagtcatgctaca
aataaatggatagaatttttgaaagaaagattatccgaagaataa

DBGET integrated database retrieval system