KEGG   Staphylococcus epidermidis RP62A: SERP2119Help
Entry
SERP2119          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144149..2144364
Genome map
AA seq 71 aa AA seqDB search
MSFYEFMQNFLGDDTPLGELVDWINQDINFPKDVTSQKEILTYFRNHPCPENIPVTSIKR
ALAVFNQFTKV
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
ttgagcttttacgaatttatgcaaaatttcctaggtgatgacacgccattaggtgaattg
gttgattggattaatcaagatatcaatttccctaaagacgtgacgagccaaaaagaaatc
ttgacatattttcgaaatcatccatgtccggaaaacataccagtgacgagtatcaaacgg
gcactagctgttttcaaccaattcactaaagtataa

DBGET integrated database retrieval system