KEGG   Staphylococcus epidermidis RP62A: SERP2122Help
Entry
SERP2122          CDS       T00229                                 

Definition
hydroxymethylglutaryl-CoA synthase (EC:2.3.3.10)
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ser00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ser00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ser00280]
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ser00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2146652..2147818
Genome map
AA seq 388 aa AA seqDB search
MNIGIDKISFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMTVSPVNQDIVSMGANAAK
DIITEEDKKNIGMVIVATESAIDNAKAAAVQIHHLLGIQPFARCFEMKEACYAATPAIQL
AKDYLAQRPNEKVLVIASDTARYGIHSGGEPTQGAGAVAMMISHNPSILKLNDDAVAYTE
DVYDFWRPTGHQYPLVAGALSKDAYIKSFQESWNEYARRHNKTLADFASLCFHVPFTKMG
QKALDSIINHADETTQDRLNSSYQDAVDYNRYVGNIYTGSLYLSLISLLETRDLKGGQTI
GLFSYGSGSVGEFFSGTLVDGFKEQLDVERHKFLLNNRIEVSVDEYEHFFKRFDQLELNH
ELEKSNADRDIFYLKSIDNNIREYHIAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtatagataaaataagtttctatgtacccaaatattatgtagacatggct
aaacttgcagaagcgcgccaagtcgatcctaataaatttttaattggaattggtcaaact
gaaatgactgtgagcccagtgaatcaagatatcgtatctatgggagccaatgctgctaaa
gatattataacagaagaagataaaaagaatattggtatggttatagtagcaactgagtct
gcgattgataatgccaaagcagcagccgttcaaattcaccatcttttaggtattcaaccc
tttgcaagatgctttgaaatgaaagaggcttgttatgcagcaacacctgcaattcaactt
gccaaagattatcttgctcaacgccctaacgaaaaggttcttgtcattgctagtgacaca
gctcgttatggtattcattctggtggtgagcctactcaaggtgccggtgcagttgcaatg
atgatttcacataacccaagtattttaaaacttaatgatgatgccgtagcatatactgaa
gacgtttatgatttctggcgtccaacgggtcatcaatatcccttagttgctggtgcattg
tcgaaagatgcctatatcaagtcattccaagaaagttggaatgaatatgcacgtcgccat
aataaaacactcgctgatttcgcttcactatgtttccatgtaccattcaccaaaatggga
caaaaagctttagattctattattaatcatgccgatgaaactacacaagaccgtcttaac
tctagttaccaagatgcagttgattataatcgttatgtcggtaatatttacacagggtcc
ttatatttaagtctcatctctttattagaaacacgtgatttaaaaggcggacaaacgatt
ggtctctttagttatggttctggttctgtaggcgagttctttagtggaacattagtagat
ggattcaaggagcaattagatgttgagcgccacaaatttttattaaataatagaatagag
gtttctgttgatgaatatgaacatttcttcaaacgctttgaccaattagaattgaatcat
gaacttgaaaaatcaaatgcagatcgtgacattttctatttaaaatctattgataacaat
attcgtgaatatcatatagcagaataa

DBGET integrated database retrieval system