KEGG   Staphylococcus epidermidis RP62A: SERP2122Help
Entry
SERP2122          CDS       T00229                                 

Definition
hydroxymethylglutaryl-CoA synthase (EC:2.3.3.10)
Orthology
K01641  
hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SERP2122
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SERP2122
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SERP2122
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SERP2122
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     SERP2122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2146652..2147818
Genome map
AA seq 388 aa AA seqDB search
MNIGIDKISFYVPKYYVDMAKLAEARQVDPNKFLIGIGQTEMTVSPVNQDIVSMGANAAK
DIITEEDKKNIGMVIVATESAIDNAKAAAVQIHHLLGIQPFARCFEMKEACYAATPAIQL
AKDYLAQRPNEKVLVIASDTARYGIHSGGEPTQGAGAVAMMISHNPSILKLNDDAVAYTE
DVYDFWRPTGHQYPLVAGALSKDAYIKSFQESWNEYARRHNKTLADFASLCFHVPFTKMG
QKALDSIINHADETTQDRLNSSYQDAVDYNRYVGNIYTGSLYLSLISLLETRDLKGGQTI
GLFSYGSGSVGEFFSGTLVDGFKEQLDVERHKFLLNNRIEVSVDEYEHFFKRFDQLELNH
ELEKSNADRDIFYLKSIDNNIREYHIAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatataggtatagataaaataagtttctatgtacccaaatattatgtagacatggct
aaacttgcagaagcgcgccaagtcgatcctaataaatttttaattggaattggtcaaact
gaaatgactgtgagcccagtgaatcaagatatcgtatctatgggagccaatgctgctaaa
gatattataacagaagaagataaaaagaatattggtatggttatagtagcaactgagtct
gcgattgataatgccaaagcagcagccgttcaaattcaccatcttttaggtattcaaccc
tttgcaagatgctttgaaatgaaagaggcttgttatgcagcaacacctgcaattcaactt
gccaaagattatcttgctcaacgccctaacgaaaaggttcttgtcattgctagtgacaca
gctcgttatggtattcattctggtggtgagcctactcaaggtgccggtgcagttgcaatg
atgatttcacataacccaagtattttaaaacttaatgatgatgccgtagcatatactgaa
gacgtttatgatttctggcgtccaacgggtcatcaatatcccttagttgctggtgcattg
tcgaaagatgcctatatcaagtcattccaagaaagttggaatgaatatgcacgtcgccat
aataaaacactcgctgatttcgcttcactatgtttccatgtaccattcaccaaaatggga
caaaaagctttagattctattattaatcatgccgatgaaactacacaagaccgtcttaac
tctagttaccaagatgcagttgattataatcgttatgtcggtaatatttacacagggtcc
ttatatttaagtctcatctctttattagaaacacgtgatttaaaaggcggacaaacgatt
ggtctctttagttatggttctggttctgtaggcgagttctttagtggaacattagtagat
ggattcaaggagcaattagatgttgagcgccacaaatttttattaaataatagaatagag
gtttctgttgatgaatatgaacatttcttcaaacgctttgaccaattagaattgaatcat
gaacttgaaaaatcaaatgcagatcgtgacattttctatttaaaatctattgataacaat
attcgtgaatatcatatagcagaataa

DBGET integrated database retrieval system