KEGG   Staphylococcus epidermidis RP62A: SERP2131Help
Entry
SERP2131          CDS       T00229                                 

Definition
cation transporter E1-E2 family ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     SERP2131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2155815..2158199
Genome map
AA seq 794 aa AA seqDB search
MANTTLTLDIIGMTCAACSNRIEKKLNRMNHVQAKVNLTTEKATIDYESDDYHLEDFVEQ
IQSLGYDVAVEQVELNINGMTCAACSNRIEKVLNQTQGVQQATVNLTTEQALIKYYPSAT
NTEALIKRIQNIGYDAETKTSSKAQSNRKKQELKHKRNKLIISAILSLPLLLVMVVHISP
ISIPSILVNPWVQLILSTPVQFIIGWQFYVGAYKNLRNGSANMDVLVAVGTSAAYFYSIY
EMMMWLTHQTHHPHLYFETSAILITLILLGKYLEARAKSQTTNALSELLNLQAKEARVIK
ENKEIMLPLDKVKVGDTLLIKPGEKIPVDGKVTKGDTSIDESMLTGESIPVEKSSGDSVI
GSTMNKNGSIMIEATQVGGDTALSHIIKVVEDAQSSKAPIQRLADIISGYFVPIVVSIAV
ITFIIWIIFVHPGQFEPALVSAISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGGQ
FVERAHYVDTIVLDKTGTITNGQPVVTDYVGDNDTLQLLASAENASEHPLADAIVTYAKD
KGLNLLDNDTFKSIPGHGIKATIHQQQILVGNRKLMNDYNISISNKLNDQLNHYEHLGQT
AMMIAVDNQINGIIAVADTVKNDAKQAIKELRNMNIDVVMLTGDNNRTAQTIAKQVGIEH
VIAEVLPEEKAHQISLLQDKGKQVAMVGDGINDAPALVKADIGMAIGTGAEVAIEAADIT
ILGGDLLLVPKAIKASKATIKNIRQNLFWAFGYNVAGIPIAACGLLAPWIAGAAMALSSV
SVVMNALRLKKMKL
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatacaacgttgactttggatattattggtatgacatgtgctgcgtgctcaaat
cgtattgaaaagaaattgaatcgtatgaatcatgttcaagctaaagtgaatctgactact
gaaaaagcaactatcgactatgagtctgacgattatcatctcgaagattttgtagagcaa
attcaaagtctcggctatgatgttgcagttgagcaagtagaattaaatataaatggtatg
acatgtgctgcatgttctaatcgtatagaaaaggttctaaatcaaacgcaaggtgtacaa
caggcaacagtaaacttaactaccgaacaagcactcatcaaatattaccctagtgctacg
aacacggaagcattaattaagcgtattcaaaatattggatacgatgctgaaactaaaact
tcatcaaaagcgcaatcaaatcgtaaaaaacaagagttaaaacataaacgcaataaatta
atcatttcagctattttatcgttgccactattattagtaatggtggtgcatatctcacct
atttccattccatccattttggtcaatccttgggtacaattaattctttcaacacctgtc
caatttattattgggtggcaattttacgttggcgcgtataaaaatttgcgaaatggttca
gctaacatggatgtattggttgctgttggtaccagtgccgcatatttttatagcatttat
gaaatgatgatgtggctcacacatcaaacacatcacccgcatttatattttgaaacaagt
gctattttaattacgttaattcttcttggtaaatatttagaagcacgtgccaaatcacag
actaccaatgcattaagcgaattgttaaatttacaagcgaaagaagcacgagtaattaaa
gaaaataaagaaattatgcttccacttgataaagttaaagtcggagatactttactaata
aaacccggcgaaaagatacctgtagatggcaaagtcactaaaggtgatacttctattgac
gaatccatgctaactggtgagtctatacctgttgaaaaaagtagtggcgattcagtgatt
ggttctaccatgaataaaaatggttcaatcatgattgaagcaactcaagtaggtggtgat
actgcattatcacatataattaaagtggttgaggatgctcaaagttctaaagcaccgatt
caacgcttagctgatattatttctggatattttgttccgattgtagttagcattgcggtt
attacttttatcatatggattatattcgttcaccccgggcaatttgaacctgcacttgtt
tcagcaatatctgttttagttattgcttgtccctgtgcacttggtttagcaacgcctaca
tctattatggtaggtacaggacgtgctgcagaaaatggcatattattcaaaggaggccaa
tttgtagaacgtgcacattatgttgatacaatcgtgctagataaaacaggcacaattact
aatggtcaacctgtagtaactgattatgttggtgacaatgatacattacaacttttagca
agtgctgaaaatgcttcagaacatcctcttgctgatgctattgttacttatgctaaagat
aaaggtcttaatttacttgataatgacacttttaaatcaattccgggacatggtattaaa
gctacgattcatcaacaacaaatccttgtgggcaatcgaaaattaatgaacgattacaat
atatctattagtaataaattaaatgaccaattaaatcactatgaacatttaggtcaaacg
gcaatgatgattgccgtggataatcaaattaatggaatcattgctgttgctgatacagta
aaaaatgatgctaaacaagcgataaaagaactaagaaatatgaatatcgacgtggttatg
ctgactggtgataacaatcgaacagctcaaaccatcgccaaacaagttggcattgaacat
gtaattgcagaagtgttgcccgaagaaaaggcacatcaaatctctttattacaagacaaa
ggtaaacaggttgccatggtcggtgatggaattaatgatgcgcctgcacttgtaaaagcc
gatattggaatggctataggcactggagctgaggtagcgattgaagctgcagatattacg
attcttggtggtgacttgctattagttccaaaagctatcaaagcaagtaaagctacgatt
aaaaatattcgacaaaatttattttgggcatttggatataacgtagctggcatcccaata
gctgcttgtggtttattagcaccttggattgccggtgctgctatggcattaagttctgtt
agcgtagttatgaatgcattaagactgaaaaaaatgaaactatag

DBGET integrated database retrieval system