KEGG   Staphylococcus epidermidis RP62A: SERP2165Help
Entry
SERP2165          CDS       T00229                                 

Definition
pyridine nucleotide-disulfide oxidoreductase
Orthology
K00359  
NADH oxidase [EC:1.6.-.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.-  Acting on NADH or NADPH
    1.6.-.-  
     SERP2165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192892..2194253
Genome map
AA seq 453 aa AA seqDB search
MKYIVVGTSHSGYEVIQTLLKEDENADIQVFESADQPSFLSCGIQSYLEDISSSLDDLHY
ASVDSYKAQGVNIHTNSTVTDLDTDNKTVVVEHQGQTATYSYDKLFLSPGGKPVTPPVDG
IEKYKHVLFMRGRDWANQIKERMKYAKKAVVVGGGYIGIEAAEAFAKAGIDTTIVDVADR
ILNTYLDKEFTDVLETNAQQHGLHFKGGETVQSLSGNQNGEVTTVVTDKNEYDADTVLFA
VGVEPATEWLKDKIDLGKKGIININHQQQTSAKDVYAGGDATLVPFAPVSEDRYIALATN
SRRQGVVAAKNMLGKEMTMPRVSGTSGLQLFDYKFGQTGIHGTEIDNYDGNLGQTYVEEL
IRPQFMQDDTKIHMKIIYDKDTHRILGGQVMSKEDITASINTISVVISAGFTLEQLAVQD
FFFQPDYDRPWHYLNVLAQQALGDTFGSDKMLF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattgtggtaggtacatctcattcaggatatgaagtgatccaaacattgctt
aaagaagatgaaaatgccgatattcaagtttttgaaagtgcagatcaaccgtccttttta
tcttgtggtattcaaagttatcttgaagacatctcatcatcattagatgatttacattac
gcatcagttgactcttataaggcacaaggtgtaaatattcatacgaatagcacagtcaca
gatttagatactgacaataagactgttgtagttgaacaccaaggtcaaacagcaacttat
tcttatgataaattgttcctaagtcctggcggcaaacctgttacccctccagtcgatgga
attgaaaaatataaacatgtattatttatgcgtggacgtgattgggcaaatcaaattaaa
gaacgcatgaaatatgccaaaaaggctgttgtagtcggtggtggctatatcggtattgaa
gctgctgaagcttttgctaaagcaggcatagatactacaatcgtagatgtcgctgatcgt
atattaaacacttacttagataaagaatttacagacgtattagaaacaaatgcacagcaa
catggtcttcattttaaaggtggcgaaacagtacaatcactttcaggaaatcaaaatggc
gaagtaactactgtagttaccgacaaaaatgaatatgacgcagatactgtcttatttgct
gtaggtgtcgaaccagctaccgagtggctaaaagataaaattgatttaggtaagaaagga
attataaacattaaccaccaacaacaaacatctgctaaagatgtctatgcgggtggcgat
gcgacattagttccttttgcaccagtatctgaggatcgttatattgcattagcaacaaat
tcaagacgtcaaggtgttgtcgcagcaaaaaacatgttgggtaaagaaatgacaatgcca
cgcgtttctggtacttcaggtttacaattatttgattataaatttggacaaactggcatt
catggtacagaaatcgataattatgatggcaatttaggtcaaacatacgtagaagaattg
attcgtcctcaatttatgcaagatgatacgaaaattcatatgaaaattatttatgataaa
gacactcaccgtatacttggtggtcaagtcatgtcaaaagaagatattactgcttctatt
aacacaatttcagtagtaatatctgctggtttcacacttgaacagctcgctgtccaagat
ttcttcttccaacctgattatgatagaccttggcattatcttaatgtgttagcccaacaa
gcattgggagatacatttggtagcgataagatgttattctaa

DBGET integrated database retrieval system