KEGG   Staphylococcus epidermidis RP62A: SERP2170Help
Entry
SERP2170          CDS       T00229                                 

Gene name
ppdK
Definition
pyruvate phosphate dikinase (EC:2.7.9.1)
Orthology
K01006  
pyruvate, orthophosphate dikinase [EC:2.7.9.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Pyruvate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SERP2170 (ppdK)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SERP2170 (ppdK)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.1  pyruvate, phosphate dikinase
     SERP2170 (ppdK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2199427..2202054)
Genome map
AA seq 875 aa AA seqDB search
MTQFVYAFNEGNIAMKDLLGGKGANLSEMKRLGLPVPDGFTITTEACITYLKQNEELPTE
VKTQLIDHLAAFSKRTGKAFSSDDNLLLVSVRSGAKISMPGMMDTILNLGLNDDNVKKLV
DKTNDARFAYDCYRRLLQMFGEVVYGIPMTAFDTYFNDFKTKHRYQNDAEIPAEGLQTIC
ERYKEIYVEEAYKPFPQEPLKQLEEAIEAVFKSWDNDRARVYRDLNDIPHDIGTAVNIQE
MVFGNSGENSGTGVAFTRNPVTGENHLFGEYLLNAQGEDVVAGIRTPKDIDTLKQQMPDV
HQEFVDVTKQLEKHYKDMQDIEFTIENGKLYLLQTRNGKRTAKAAIKIAVDLVHEQLITR
EEAVSKVEVKSIDQLLHPNFNEEALKQATVVSKMGLPASPGAATGKVVFSAEEAKLQAEN
GNKVVLMRPETSPEDIEGMVASEAIVTTHGGMTSHAAVVARGMGKCCVTGCSNVEIDTVN
KTVYYPEGELHEGDIISVDGSAGDLYLGAIETVNAEHSEEFDQFMTWSEEIARLQVRMNA
ETPQDIKAGYDFGSKGIGLVRTEHMFFGPERLIEMRRFILASNHDERVQALEKIKTYQVE
DFETIFRLSQDRPTIVRLLDPPLHEFLPSSEEDINNVSQQLNVSSEFLRKRIVDLNEVNP
MLGHRGCRLAVTYPELYEMQVEAIIESVIKLQKEGVTCLPEIMIPLVSTVEEFTTLKERL
VNTITHLEKESQQDIQYMIGTMIETPRACLIANDLAKHCDFFSFGTNDLTQLTFGFSRDD
AGKFINVYTENNILQLDPFQTLDREGVGRLIQLAVEQAKNTNPEIKIGVCGELGGDAKSI
RQFNQWEIDYVSCSPFRVPGAILATAQSQAEESER
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattcgtttatgcatttaatgaaggaaatatagctatgaaagacttacttggt
ggtaaaggtgccaatctttcagagatgaagagactcggactaccagtacctgatggtttt
acaattacgactgaagcttgtattacatatttaaaacaaaatgaagaactacctacagaa
gtaaagacacaattaattgatcatttagcagctttttctaagcgaacaggaaaagccttt
tcttctgatgataacttgttattagtatcagtacgtagtggtgcaaaaatttccatgcca
ggaatgatggatacaattcttaatttaggacttaatgatgataatgtaaaaaagcttgtt
gacaaaacaaatgatgcacgatttgcatatgattgttaccgtcgtttactacaaatgttt
ggagaggttgtttatggtattccaatgacagctttcgatacatattttaatgattttaaa
acaaagcatcgttatcaaaatgatgctgaaattccggcagaaggactacaaactatatgt
gaaagatataaagaaatctatgtagaagaggcatataaaccttttccccaagaaccgtta
aagcaattagaagaagcaattgaggcagtatttaaatcttgggataatgatcgtgcacgt
gtatatagagatttaaatgatattccacatgatattggtacagctgtaaatattcaggaa
atggtatttggtaatagtggtgaaaatagtggtacgggtgtagcatttacaagaaatcca
gttactggagaaaatcatttattcggagagtacttacttaatgcccaaggtgaagatgtt
gttgcaggcattcgtacccctaaggatattgacactttaaaacaacaaatgccagatgta
catcaagagtttgttgatgtaaccaaacaacttgaaaagcattacaaagatatgcaagac
atagaatttacaattgaaaatggtaaactttatttattacaaacacgtaacggaaaacgt
actgctaaagctgcaataaaaattgctgtggatttagttcacgagcaattaattacacgt
gaagaagcagtatcaaaagtagaagtaaaatcaatagaccaattattacatcctaatttt
aatgaagaagcattaaagcaagcgacagtagtttctaaaatgggcttaccagctagtccc
ggtgcagcaacaggaaaagtagtcttctctgctgaagaagcaaaacttcaagctgaaaat
ggtaataaagtagtgttaatgcgaccggaaacatcacctgaagatattgaggggatggta
gcaagtgaagcaatcgtaacaactcatggtggtatgacatcacacgctgctgttgtagca
agagggatgggtaaatgttgtgtgacaggatgttcgaatgtagagatagatacagtgaac
aaaacagtatattatcctgaaggtgaattacatgaaggggatatcatttcagtagatggt
tcagctggtgatttatatttaggagcaattgaaacagtcaatgctgaacatagtgaagag
ttcgatcaatttatgacttggtctgaagagattgcaagattgcaagttagaatgaatgct
gaaacaccacaagacataaaagctggatatgattttggctctaaaggaataggtttagtt
cgtactgagcatatgttctttggacctgaacgtttaatagaaatgcgccgttttatctta
gcttcaaatcatgacgaacgtgtacaagctttagaaaaaattaaaacataccaagtagaa
gattttgaaacaattttcagattatctcaagatagacctacgattgttcgtttacttgat
ccaccgttacatgagttcttgccatcatctgaagaagatataaacaatgtttctcaacag
ctgaatgtatcttcagagttcttacgcaagcgaatcgttgacttaaatgaggtcaatcca
atgcttggtcatcgtggttgtcgtttggctgtgacttatccagagttatatgagatgcaa
gttgaagctattattgaaagtgttattaagcttcaaaaagagggcgtaacgtgcctacca
gaaattatgattcctctagtgtcaacagtagaagaatttacaactttaaaagaacgatta
gttaatacaattacacatttagaaaaagaatcacaacaagatatacaatatatgataggc
actatgattgaaacgcctagagcatgcttgattgcgaatgaccttgcgaaacattgtgat
ttcttcagttttggtactaatgatttaacgcaattgacatttggtttctctagagatgat
gcaggaaaattcataaatgtgtatactgaaaataacattttacagcttgacccattccaa
actttagatagagaaggtgtaggacgactaattcaattagccgttgaacaagctaaaaat
acaaatccagagataaaaattggtgtatgtggtgagcttggtggcgatgcaaaatcaatt
cgtcaatttaaccaatgggaaattgattatgtttcatgttcaccatttagagttccgggt
gcaattttagctacagctcagagtcaagcggaggaaagcgagcgataa

DBGET integrated database retrieval system