KEGG   Staphylococcus epidermidis RP62A: SERP2173Help
Entry
SERP2173          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2204338..2204784)
Genome map
AA seq 148 aa AA seqDB search
MLISDTNKTYIIEETSNSFTIERNNDQQHYEVLESINSLSNDSFCVLNHLFVNGGNEEVF
ESRFLKRNQYLQDVSGFKALRFLRPLVKGRHYIIITLWNSRQAFYDWQNSQAYAQTHKKR
GTQKGVDHRIVNRDLSYNIRIELESLNN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttaattagcgatacaaataaaacatatataatagaagaaactagtaattcattcaca
attgaaaggaataatgatcagcagcactacgaagtattagaatcaatcaatagtttatct
aatgattcattttgtgtgttaaatcacttattcgtcaatggaggaaatgaagaggttttt
gagtcacgttttttaaagagaaatcaatatcttcaagatgtatctggatttaaagcgtta
aggtttcttagacctttagtcaaagggagacattacattatcatcacgctatggaacagt
agacaagctttctatgattggcaaaattcacaagcatatgcgcaaactcataaaaagcgt
gggactcaaaaaggtgtcgatcatcgtatagtcaatagagatttatcctataatataaga
atagagttagaaagtcttaataactaa

DBGET integrated database retrieval system