KEGG   Staphylococcus epidermidis RP62A: SERP2173Help
Entry
SERP2173          CDS       T00229                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K21481  
heme oxygenase (mycobilin-producing) [EC:1.14.99.57]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.57  heme oxygenase (mycobilin-producing)
     SERP2173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2204338..2204784)
Genome map
AA seq 148 aa AA seqDB search
MLISDTNKTYIIEETSNSFTIERNNDQQHYEVLESINSLSNDSFCVLNHLFVNGGNEEVF
ESRFLKRNQYLQDVSGFKALRFLRPLVKGRHYIIITLWNSRQAFYDWQNSQAYAQTHKKR
GTQKGVDHRIVNRDLSYNIRIELESLNN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttaattagcgatacaaataaaacatatataatagaagaaactagtaattcattcaca
attgaaaggaataatgatcagcagcactacgaagtattagaatcaatcaatagtttatct
aatgattcattttgtgtgttaaatcacttattcgtcaatggaggaaatgaagaggttttt
gagtcacgttttttaaagagaaatcaatatcttcaagatgtatctggatttaaagcgtta
aggtttcttagacctttagtcaaagggagacattacattatcatcacgctatggaacagt
agacaagctttctatgattggcaaaattcacaagcatatgcgcaaactcataaaaagcgt
gggactcaaaaaggtgtcgatcatcgtatagtcaatagagatttatcctataatataaga
atagagttagaaagtcttaataactaa

DBGET integrated database retrieval system