KEGG   Staphylococcus epidermidis RP62A: SERP2195Help
Entry
SERP2195          CDS       T00229                                 

Definition
alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase
Orthology
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SERP2195
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     SERP2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2228098..2229441)
Genome map
AA seq 447 aa AA seqDB search
MKQYDVVFLGSGHAAWHAALTLKQSGKQVAIVEKDTIAGTCTNYGCNAKIFLEGPYEVLE
EAKQYPNIIDSHNLEVNWKNLMHYKEQVINPMSETLTSMFEQQGIDVIMGKGKLVDAHTI
GVNNTTLQSDYIVIATGQHSHQLDIEGKEYTHDSREFLSMQSLPDSITFIGAGIISIEFA
SIMIKSGVEVNVVHHTNQALEGFNESHVNKLIQKLKDEGVKFYFSENTKSVKPNAQRFIV
ETESGKMIETDYVLDATGRKPNVQQIGLEKVGILFSDRGIEVDDYLRTNVKNIYASGDVI
NKMIPKLTPTATFESNYIAAHILGLNTDAIQYPPIPSVLYSLPRLSQIGVTVSEAKKDDT
YMIKDIPFGRQMVFEYQNETEAEMSIVLDSHKRLVGAEIYGNDAGDLVNLLVFIINQKLT
AQDLNKNIFAIPGASSGVIDLLKLAMM
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatatgatgtagtatttttaggaagtggtcatgcagcttggcatgctgcgtta
acattaaagcaaagtggtaagcaagtagctatagttgaaaaagatactatcgccggtaca
tgtactaactatggttgtaatgcgaaaatttttttagagggaccttatgaagtgcttgaa
gaagccaaacaatatcctaatattattgatagtcacaatttagaagtgaattggaagaat
ttaatgcattacaaagaacaagtcattaatcctatgtctgaaaccctcacatcgatgttt
gaacaacagggaattgatgtaatcatggggaaaggtaaacttgtagatgctcatacaata
ggggtaaataatacaactttacaatcagattatattgttatagcaactggacaacatagt
catcaattagatattgagggtaaagaatatacgcatgatagtcgggaatttttatcaatg
caatctttaccggatagtatcacttttattggagcaggtattatcagtattgaattcgct
tctatcatgatcaaatctggtgtagaggttaatgtggttcatcatacaaatcaggcactt
gaagggtttaacgaatcacacgtcaataaattaattcaaaagttaaaagatgaaggtgtt
aaattttactttagtgagaataccaagtcagttaaaccgaatgcacaacgttttatagta
gaaactgagtctggaaagatgattgaaacagattatgtactggatgcaaccggtagaaag
cctaatgttcagcaaataggtttggaaaaagtgggtatactatttagtgatagaggtatt
gaggttgacgattatttaagaacaaatgtgaaaaatatatacgcaagtggggacgttatc
aataaaatgattcctaaacttactcctacagctacatttgagtctaattatatcgctgcc
catatccttggattgaatacagatgccattcagtatccaccaataccttcagtgctttat
tcattgcctcgtttatctcaaataggtgtcacagttagcgaggctaagaaagatgatacg
tatatgattaaagatataccattcggaagacaaatggtatttgagtatcaaaacgaaaca
gaggctgaaatgtcaattgtattagatagtcacaaacgtttagtaggagcagagatttat
ggtaatgacgctggtgatttggttaatctcctagtctttatcattaatcaaaaacttact
gcacaagacttaaataaaaatatttttgcaattcctggagcttctagtggcgttatagat
ttattgaaattggcgatgatgtag

DBGET integrated database retrieval system