KEGG   Staphylococcus epidermidis RP62A: SERP2195Help
Entry
SERP2195          CDS       T00229                                 

Definition
alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase
Orthology
K00383  
glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ser00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2228098..2229441)
Genome map
AA seq 447 aa AA seqDB search
MKQYDVVFLGSGHAAWHAALTLKQSGKQVAIVEKDTIAGTCTNYGCNAKIFLEGPYEVLE
EAKQYPNIIDSHNLEVNWKNLMHYKEQVINPMSETLTSMFEQQGIDVIMGKGKLVDAHTI
GVNNTTLQSDYIVIATGQHSHQLDIEGKEYTHDSREFLSMQSLPDSITFIGAGIISIEFA
SIMIKSGVEVNVVHHTNQALEGFNESHVNKLIQKLKDEGVKFYFSENTKSVKPNAQRFIV
ETESGKMIETDYVLDATGRKPNVQQIGLEKVGILFSDRGIEVDDYLRTNVKNIYASGDVI
NKMIPKLTPTATFESNYIAAHILGLNTDAIQYPPIPSVLYSLPRLSQIGVTVSEAKKDDT
YMIKDIPFGRQMVFEYQNETEAEMSIVLDSHKRLVGAEIYGNDAGDLVNLLVFIINQKLT
AQDLNKNIFAIPGASSGVIDLLKLAMM
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatatgatgtagtatttttaggaagtggtcatgcagcttggcatgctgcgtta
acattaaagcaaagtggtaagcaagtagctatagttgaaaaagatactatcgccggtaca
tgtactaactatggttgtaatgcgaaaatttttttagagggaccttatgaagtgcttgaa
gaagccaaacaatatcctaatattattgatagtcacaatttagaagtgaattggaagaat
ttaatgcattacaaagaacaagtcattaatcctatgtctgaaaccctcacatcgatgttt
gaacaacagggaattgatgtaatcatggggaaaggtaaacttgtagatgctcatacaata
ggggtaaataatacaactttacaatcagattatattgttatagcaactggacaacatagt
catcaattagatattgagggtaaagaatatacgcatgatagtcgggaatttttatcaatg
caatctttaccggatagtatcacttttattggagcaggtattatcagtattgaattcgct
tctatcatgatcaaatctggtgtagaggttaatgtggttcatcatacaaatcaggcactt
gaagggtttaacgaatcacacgtcaataaattaattcaaaagttaaaagatgaaggtgtt
aaattttactttagtgagaataccaagtcagttaaaccgaatgcacaacgttttatagta
gaaactgagtctggaaagatgattgaaacagattatgtactggatgcaaccggtagaaag
cctaatgttcagcaaataggtttggaaaaagtgggtatactatttagtgatagaggtatt
gaggttgacgattatttaagaacaaatgtgaaaaatatatacgcaagtggggacgttatc
aataaaatgattcctaaacttactcctacagctacatttgagtctaattatatcgctgcc
catatccttggattgaatacagatgccattcagtatccaccaataccttcagtgctttat
tcattgcctcgtttatctcaaataggtgtcacagttagcgaggctaagaaagatgatacg
tatatgattaaagatataccattcggaagacaaatggtatttgagtatcaaaacgaaaca
gaggctgaaatgtcaattgtattagatagtcacaaacgtttagtaggagcagagatttat
ggtaatgacgctggtgatttggttaatctcctagtctttatcattaatcaaaaacttact
gcacaagacttaaataaaaatatttttgcaattcctggagcttctagtggcgttatagat
ttattgaaattggcgatgatgtag

DBGET integrated database retrieval system