KEGG   Staphylococcus epidermidis RP62A: SERP2205Help
Entry
SERP2205          CDS       T00229                                 

Definition
(RefSeq) sensor histidine kinase
  KO
K19081  
two-component system, OmpR family, sensor histidine kinase BraS/BceS [EC:2.7.13.3]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
BraS-BraR (bacitracin transport) two-component regulatory system
Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP2205
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SERP2205
Protein kinases [BR:ser01001]
 Histidine protein kinases
  OmpR family
   SERP2205
Two-component system [BR:ser02022]
 OmpR family
  BraS-BraR [MD:M00734]
   SERP2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2240445..2241350)
Genome map
AA seq 301 aa AA seqDB search
MRHMKFAYIQSIRNEISIILIILLFFALIFYVFSLPFDAYVLAISIILLLMCVRWWIKYL
SFKKNEHLKDKVAYLEHELAHVKNQQIEYRNDVESYFLTWVHQIKTPITASQLLLERNEE
NVVNRVRQEIVHIDNYTSLALSYLKLLNEESDMTITKVTVDDLIRPLLLKYRIQFIEQKT
QIHYKKSEDIILTDAQWASIMIEQLLNNALKYAKGKDIWIDFDVANQTLQIKDNGIGISK
ADIPKIFDKGYSGFNGRLNEQSTGIGLFIVQHIANHLNIQVTVQSELNHGTVFFIHFTKE
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgagacatatgaagtttgcatatattcaatcgattcgtaatgagatttcaattatttta
ataattctattattttttgcacttatattttatgtgttttctttaccttttgatgcatac
gtacttgcaatcagtataatattactattgatgtgtgtacgttggtggataaagtattta
agttttaaaaagaacgaacatcttaaagataaagtagcatatttagaacatgagttagca
catgttaagaatcagcaaattgaatatcgtaacgatgttgaaagttattttttaacatgg
gtacatcaaattaaaacacctatcactgcctcacaattacttttggagagaaacgaggag
aatgtagttaatcgtgttagacaagaaattgtgcacattgataattatacaagtctcgca
ttaagttatttaaaattattaaatgaagagtcagatatgacaattaccaaagtgacagtt
gatgatttgattcgcccgttgcttttaaaatatagaattcagtttattgagcaaaagacg
caaatccattataaaaaaagtgaggacattattttaaccgatgcacaatgggcgtctata
atgatagagcaacttttaaataatgctttaaaatatgctaaaggtaaagatatttggata
gattttgatgttgccaatcaaactctacagattaaagataatggtattgggattagtaaa
gcagatattcctaaaatttttgataaaggatactcaggatttaacggtagattgaatgaa
caatcaactggtataggtttatttatagtgcaacacattgcaaatcatttaaatatacaa
gtaactgtacaatcagaattgaatcatgggacagtattttttatacattttactaaagaa
aaataa

DBGET integrated database retrieval system