KEGG   Staphylococcus epidermidis RP62A: SERP2205Help
Entry
SERP2205          CDS       T00229                                 

Definition
sensor histidine kinase
Orthology
K00936  
[EC:2.7.3.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.-  
     SERP2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2240445..2241350)
Genome map
AA seq 301 aa AA seqDB search
MRHMKFAYIQSIRNEISIILIILLFFALIFYVFSLPFDAYVLAISIILLLMCVRWWIKYL
SFKKNEHLKDKVAYLEHELAHVKNQQIEYRNDVESYFLTWVHQIKTPITASQLLLERNEE
NVVNRVRQEIVHIDNYTSLALSYLKLLNEESDMTITKVTVDDLIRPLLLKYRIQFIEQKT
QIHYKKSEDIILTDAQWASIMIEQLLNNALKYAKGKDIWIDFDVANQTLQIKDNGIGISK
ADIPKIFDKGYSGFNGRLNEQSTGIGLFIVQHIANHLNIQVTVQSELNHGTVFFIHFTKE
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgagacatatgaagtttgcatatattcaatcgattcgtaatgagatttcaattatttta
ataattctattattttttgcacttatattttatgtgttttctttaccttttgatgcatac
gtacttgcaatcagtataatattactattgatgtgtgtacgttggtggataaagtattta
agttttaaaaagaacgaacatcttaaagataaagtagcatatttagaacatgagttagca
catgttaagaatcagcaaattgaatatcgtaacgatgttgaaagttattttttaacatgg
gtacatcaaattaaaacacctatcactgcctcacaattacttttggagagaaacgaggag
aatgtagttaatcgtgttagacaagaaattgtgcacattgataattatacaagtctcgca
ttaagttatttaaaattattaaatgaagagtcagatatgacaattaccaaagtgacagtt
gatgatttgattcgcccgttgcttttaaaatatagaattcagtttattgagcaaaagacg
caaatccattataaaaaaagtgaggacattattttaaccgatgcacaatgggcgtctata
atgatagagcaacttttaaataatgctttaaaatatgctaaaggtaaagatatttggata
gattttgatgttgccaatcaaactctacagattaaagataatggtattgggattagtaaa
gcagatattcctaaaatttttgataaaggatactcaggatttaacggtagattgaatgaa
caatcaactggtataggtttatttatagtgcaacacattgcaaatcatttaaatatacaa
gtaactgtacaatcagaattgaatcatgggacagtattttttatacattttactaaagaa
aaataa

DBGET integrated database retrieval system