KEGG   Staphylococcus epidermidis RP62A: SERP2206Help
Entry
SERP2206          CDS       T00229                                 

Definition
DNA-binding response regulator
Orthology
K19082  
two-component system, OmpR family, response regulator protein BraR/BceR
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
Two-component system
Module
BraS-BraR (bacitracin transport) two-component regulatory system
Bacitracin resistance, VraDE transporter
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SERP2206
Two-component system [BR:ser02022]
 OmpR family
  BraS-BraR [MD:M00734]
   SERP2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2241347..2242012)
Genome map
AA seq 221 aa AA seqDB search
MKIFIVEDDLVIAESLANELSKWNYEVHVVDNFEKIMEDFRRVEPQLVLLDINLPTLNGF
HWCQEMRKVSHVPIMFISSRTDNMDQILAIQMGGDDFIEKPFNLSLTVAKIQALLRRTYD
LSIARDEIAVKGCKLIVDEAKLSKDNEHVQLSLTELQILKLLFQNENKYVSRTALIEKCW
ESENFIDDNTLAVNMTRLRKKLLSIGVDDLIETKKNVGYRV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttcattgtagaagacgatttagtgattgctgaaagtttagctaatgagcta
tctaaatggaattatgaggtgcatgtggttgataattttgaaaagataatggaagatttt
cgccgagtagaaccacaactcgtattattagatatcaatctaccaacacttaatggcttc
cattggtgccaagaaatgcgaaaagtatctcatgtgcctattatgtttattagttcaaga
acagataatatggatcaaattctggctatccaaatgggtggcgatgattttatcgagaaa
ccatttaacttgtctttaacagtagctaaaattcaggcactattgcgtcgcacttatgat
ttatcaatagctcgtgatgaaatagctgttaaaggttgtaaactaattgttgatgaggcc
aagcttagcaaggataatgaacatgttcaactttccttaacagagctacagatattaaaa
ttgttatttcaaaatgaaaataaatatgtaagtcgtacagctttaattgagaagtgttgg
gagtctgagaattttattgatgacaatacgctcgcagtaaatatgacacgattacgaaaa
aaattactttctatcggtgtcgatgatttaattgagacaaagaaaaatgtaggatatagg
gtttga

DBGET integrated database retrieval system