KEGG   Staphylococcus epidermidis RP62A: SERP2235Help
Entry
SERP2235          CDS       T00229                                 

Definition
hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2266163..2266258
Genome map
AA seq 31 aa AA seqDB search
MMLIFVHIIAPVISGCAIAFFTHWLSKCNKK
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcttattttcgttcacatcatagcgccagtcatcagtggctgtgccattgcgttt
tttactcattggctaagtaaatgcaataaaaagtag

DBGET integrated database retrieval system