KEGG   Staphylococcus epidermidis RP62A: SERP2265Help
Entry
SERP2265          CDS       T00229                                 

Definition
organic hydroperoxide resistance protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2300398..2300826
Genome map
AA seq 142 aa AA seqDB search
MTNSIYSTTMISNGGRDGRVFSPDNTFVQSLATPKEMGGQGGNDTNPEQLFAAGYSACFN
SALSLILSQNKISDANPEVEITIELLKDDTDNGFKLGADIKVTLENMSQQDAEKFVEQAH
QFCPYSKATRGNIDVQLDVTAQ
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgacaaattctatttactcaactacaatgatttcaaatggtggacgtgatggtcgcgtt
tttagtccagataatacatttgttcaaagccttgcaacacctaaggaaatgggtggtcaa
ggaggcaacgatactaatcctgaacaattatttgctgctggatatagtgcatgctttaat
agcgcgctatcattaatcttatctcaaaataaaataagtgatgccaacccagaagttgaa
atcactattgaattacttaaagatgatactgacaatggttttaaacttggcgcagatatt
aaagtcacacttgaaaatatgtcccaacaagatgctgagaaatttgtggagcaagcacat
caattctgtccatactcaaaagcgacacgtggtaacattgacgttcagttagatgttaca
gcgcaataa

DBGET integrated database retrieval system