KEGG   Staphylococcus epidermidis RP62A: SERP2285Help
Entry
SERP2285          CDS       T00229                                 

Definition
phosphonate ABC transporter ATP-binding protein
Orthology
K02041  
phosphonate transport system ATP-binding protein [EC:3.6.3.28]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ABC transporters
Module
Phosphonate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ser02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2325528..2326301)
Genome map
AA seq 257 aa AA seqDB search
MSQIEFKDVSKVYPNGHVGLKDINLNIEKGDFAVIVGLSGAGKSTLLRSVNRLHDISKGD
ITIEGQSITKARGKKLLEMRRSIGMIFQHFNLVKRSTVLRNVLSGRVGYHPTWKMILGLF
PKEDKVKALDALERVNILDKYDQRSDQLSGGQQQRISIARALCQEPTIILADEPVASLDP
LTTKQVMDDLKKINEELGITILINLHFVDLAKEYGSRIIGLRAGELVYDGPASEANDEVF
NHIYGRSIKDDEKLGVE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaatcgaatttaaggatgttagtaaagtgtatccaaatggccatgtgggatta
aaagatattaacttaaatatagaaaaaggtgattttgcagttattgttggattgtctgga
gcaggtaaatcaacattactacgatcggttaatcggctacatgatatttccaaaggtgat
attactatcgaaggtcagtcaataactaaagcacgtggtaaaaaattattagaaatgcgt
cgaagtataggtatgatttttcaacattttaacttagttaagcgttcaacagtgcttaga
aacgttttgagtggcagggtaggataccatcctacttggaaaatgatacttggtcttttt
cctaaagaagataaagtcaaggcattggatgctttagaacgtgtaaacattttagataaa
tatgaccaacgctctgaccagttgtcaggtggtcaacaacaacgtatatcaatagctaga
gcgttatgtcaggaaccaaccattatattagcagacgaaccagttgcttcattagatcca
ttaactacaaaacaagtgatggatgacttaaagaaaatcaatgaagaacttggtattact
attttaattaatttacactttgtagatttggcaaaggaatacggatcgagaataattggt
ttaagagcgggagagctcgtttatgatggacccgcgtctgaggcaaatgacgaagtattt
aatcatatatacggtcgctctattaaggacgatgaaaaattaggggtggaataa

DBGET integrated database retrieval system